TkA01G482360 | RubberDandelionOmics

Gene overview

TkA01G482360

Reference: TK1151 Chr: Chr01 Coordinates: 120773594-120776383 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2709 bp · TkA01G482360|TK1151|cDNA

AAACAACTACTTCTTCTGTGTAGCGGCTGCGAAGGATTTCATCCCTCTTTCTCTATCGTCTCTCCGAGAACCTTATCACCAATCTCTCTCTCTTTATCTAAATCCTTATCCCCAATTTCACACACTATCATAAACCCTAGTTATCCAATTCATTATACTTGCATCGAGTTCACGTAGTACGAGTATTGGTGTAGTTCAGAATCCATGGACTCGAAGGAAGATACGTCTCTCTCAGGTTTTTCTTCTGTTTCTTCCGATAA...

CDS

Download CDS FASTA

1872 bp · TkA01G482360|TK1151|CDS

ATGAAGTTAAATCTGGTACTCCTGAAGAAGGAGAGAAAGAGGTGGTTTGTTGCCAATGGTGTGAAGCTTACTCCAGAAGGAGATGCGGTTGTGGAAGAAATAAAAGTTGATACACCTGTACCAGGTGTTGCTGTAGTTTCTAATATAGAAGATGTTGAGGAAGACGATGAGGATGAAGAAGTGCTTCTAGTTGGTGGCCCCGATGACACTAATTCTGTTGTTGAAGAACCTGAATTAGAATCTTTTGGTGCAGATGATGT...

Protein

Download Protein FASTA

623 aa · TkA01G482360|TK1151|PROTEIN

MKLNLVLLKKERKRWFVANGVKLTPEGDAVVEEIKVDTPVPGVAVVSNIEDVEEDDEDEEVLLVGGPDDTNSVVEEPELESFGADDVKITSDLESVGANDVKITSESDSVVEAVDVDLPVAGVPGVAVVTKTEEDGGVVADESGFSEKLDRVIEEVVDKEVVEVTDGKFSPLVEGSVVDDDDTEKNEKNPEAEIEKEVDYEVKQNGPVVKTALDDVADMSTTNLASDTTQAPESLDKDTPDEPQVTEVLDKDLPDDADGK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G482360`
TK1151 ID	TkA01G482360
OH-1004 ID	LXL04_037059
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.600
Protein coverage (%)	TK1151 95.827 / OH-1004 43.759 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G482360

Location Chr01:120773594-120776383 (+)

Description Similar to TOC159: Translocase of chloroplast 159, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g02510`	GTPase involved in protein precursor import into chloroplasts.	The major protein import receptor of plastids is essential for chloroplast biogenesis.2000 · DOI: 10.1038/35003214 Dimerization of Toc-GTPases at the chloroplast protein import machinery.2003 · DOI: 10.1074/jbc.m305946200 The roles of toc34 and toc75 in targeting the toc159 preprotein receptor to chloroplasts.2003 · DOI: 10.1074/jbc.m307873200 Functional specialization amongst the Arabidopsis Toc159 family of chloroplast protein import receptors.2004 · DOI: 10.1105/tpc.104.023309 AtToc90, a new GTP-binding component of the Arabidopsis chloroplast protein import machinery.2004 · DOI: 10.1023/b:plan.0000036374.92546.51 Deletion of core components of the plastid protein import machinery causes differential arrest of embryo development in Arabidopsis thaliana.2006 · DOI: 10.1055/s-2005-873044
`At2g16640`	GTPase involved in protein precursor import into chloroplasts.	Functional specialization amongst the Arabidopsis Toc159 family of chloroplast protein import receptors.2004 · DOI: 10.1105/tpc.104.023309 Deletion of core components of the plastid protein import machinery causes differential arrest of embryo development in Arabidopsis thaliana.2006 · DOI: 10.1055/s-2005-873044
`At3g16620`	GTPase involved in protein precursor import into chloroplasts.	Functional specialization amongst the Arabidopsis Toc159 family of chloroplast protein import receptors.2004 · DOI: 10.1105/tpc.104.023309

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037059 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0045036 protein targeting to chloroplast Biological Process

GO:0045037 protein import into chloroplast stroma Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009707 chloroplast outer membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0061927 TOC-TIC supercomplex I Cellular Component

GO:0003924 GTPase activity Molecular Function

GO:0004888 transmembrane signaling receptor activity Molecular Function

GO:0004930 G protein-coupled receptor activity Molecular Function

KEGG gene cross-reference

ath:AT2G16640

ath:AT3G16620

ath:AT4G02510

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.370

Rank 1 · TkA01G482360 · TK1151

Nucleus0.260

Rank 2 · TkA01G482360 · TK1151

Endoplasmic reticulum0.233

Rank 3 · TkA01G482360 · TK1151

Cell membrane0.143

Rank 4 · TkA01G482360 · TK1151

Golgi apparatus0.141

Rank 5 · TkA01G482360 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02421FeoB_N109-159 aa

PF13191AAA_16402-414 aa

PF00735Septin551-586 aa

PF04548AIG1554-609 aa

PF02421FeoB_N554-609 aa

PF13191AAA_16554-573 aa

PF01926MMR_HSR1555-610 aa

PF03193RsgA_GTPase555-583 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G482360	`PF02421`	FeoB_N	109	159	0.048	13.9
TkA01G482360	`PF13191`	AAA_16	402	414	0.061	14.6
TkA01G482360	`PF00735`	Septin	551	586	0.0048	16.9
TkA01G482360	`PF04548`	AIG1	554	609	6.5e-09	36.1
TkA01G482360	`PF02421`	FeoB_N	554	609	0.048	13.9
TkA01G482360	`PF13191`	AAA_16	554	573	0.061	14.6
TkA01G482360	`PF01926`	MMR_HSR1	555	610	1.8e-07	31.9
TkA01G482360	`PF03193`	RsgA_GTPase	555	583	0.049	14.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81283`	Arabidopsis thaliana	sp\|O81283\|TC159_ARATH Translocase of chloroplast 159, chloroplastic	56.500%	Swiss-Prot	Low
`Q9SLF3`	Arabidopsis thaliana	sp\|Q9SLF3\|TC132_ARATH Translocase of chloroplast 132, chloroplastic	46.900%	Swiss-Prot	Low
`Q9LUS2`	Arabidopsis thaliana	sp\|Q9LUS2\|TC120_ARATH Translocase of chloroplast 120, chloroplastic	49.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card