TkA01G475420 | RubberDandelionOmics

Gene overview

TkA01G475420

Reference: TK1151 Chr: Chr01 Coordinates: 119033930-119035827 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1025 bp · TkA01G475420|TK1151|cDNA

AAAGTATATGCTCTGTAGGTTTAGAACCGATGGAAAGAAAGGAACGGTTCCCTCTTCTCTTCTCTAAATGATTTTATTAGCCGCCGCCCTAAATCACAACCGCCGCCACACCAGTACTCGTCGGCCGGTTTAACTGAGAAGGAAAGCAACATGAGAGGGGTTCACGAGAGAGAGTTCTGGCAGAAAAGAAGACGAGCGAAACGTGAGGTACTACCGGGAAGATGGAGGCTGTTGGAAGTGGTCGCCGTAGAAGAGCCCAA...

CDS

Download CDS FASTA

441 bp · TkA01G475420|TK1151|CDS

ATGCCACCAGGGGCAGCATGGGAGTTTAATTCGGGATTCACACGTTTCAACATTCAAAGGTGGTGGTGGTGTGAAGTGCAGTGGCTTAGCAAAGTTGTCCGATATTTTTCTCGTCCACGGGTTCAATGTAAAAAGAAGTTACCGTTAGTGGAGAAAAAGATCATGAGAGAGAAAAATGACAAGTCACGATGTGGGTCGAGAAAAGTATGGAAATGGAAGGAGGAGTATGGTGGCACAATATTAAAAGAACTTTGGCGGTT...

Protein

Download Protein FASTA

146 aa · TkA01G475420|TK1151|PROTEIN

MPPGAAWEFNSGFTRFNIQRWWWCEVQWLSKVVRYFSRPRVQCKKKLPLVEKKIMREKNDKSRCGSRKVWKWKEEYGGTILKELWRLGASLDWSRKEWKYPSLANALDPSKRLKKPLHHHWTLNCRMHQPHLKRTKPGAESNPSKQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G475420`
TK1151 ID	TkA01G475420
OH-1004 ID	LXL04_028552
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	69.200
Protein coverage (%)	TK1151 32.192 / OH-1004 4.915 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G475420

Location Chr01:119033930-119035827 (-)

Description Similar to TWN2: Valine--tRNA ligase, mitochondrial 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g14610`	Required for embryo development and seed viability.	Suspensor-derived polyembryony caused by altered expression of valyl-tRNA synthetase in the twn2 mutant of Arabidopsis.1997 · DOI: 10.1073/pnas.94.14.7349

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028552 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006418 tRNA aminoacylation for protein translation Biological Process

GO:0006438 valyl-tRNA aminoacylation Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0031012 extracellular matrix Cellular Component

GO:0097225 sperm midpiece Cellular Component

GO:0097228 sperm principal piece Cellular Component

KEGG gene cross-reference

ath:AT1G14610

ddi:DDB_G0277733

hsa:7407

mmu:22321

rno:25009

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.473

Rank 1 · TkA01G475420 · TK1151

Cytoplasm0.330

Rank 2 · TkA01G475420 · TK1151

Mitochondrion0.151

Rank 3 · TkA01G475420 · TK1151

Cell membrane0.102

Rank 4 · TkA01G475420 · TK1151

Endoplasmic reticulum0.060

Rank 5 · TkA01G475420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00133tRNA-synt_150-96 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G475420	`PF00133`	tRNA-synt_1	50	96	0.00035	20.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P93736`	Arabidopsis thaliana	sp\|P93736\|SYVM1_ARATH Valine--tRNA ligase, mitochondrial 1	57.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card