LXL04_028552 | RubberDandelionOmics

Gene overview

LXL04_028552

Reference: OH-1004 Chr: Chr06 Coordinates: 45386407-45391657 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3177 bp · LXL04_028552|LXL04_028552|OH1004|cDNA

ATGGCCATCACAAATCCTGATGTTTCTCTTTCTGAGGAGGAACTCGAGaggaaaaagaagaaagaagagaagGCAAAAGAGAAAGAGTTGAAGAGACTCAAGGCGGCTCAGAAAGCGGAAGCAGCCAAACTTAAGGCACAACAAGGGACTTCTTCCATGAAAGCCAGTAAGAAGAAGACTGTAAGGGCAGATGCAAGTGAAGAAAATCCACAGGATTTCATAGATCCAGAAACACCTTCTGGTGATAAGAAAAAGCTTTC...

CDS

Download CDS FASTA

3177 bp · LXL04_028552|LXL04_028552|OH1004|CDS

ATGGCCATCACAAATCCTGATGTTTCTCTTTCTGAGGAGGAACTCGAGAGGAAAAAGAAGAAAGAAGAGAAGGCAAAAGAGAAAGAGTTGAAGAGACTCAAGGCGGCTCAGAAAGCGGAAGCAGCCAAACTTAAGGCACAACAAGGGACTTCTTCCATGAAAGCCAGTAAGAAGAAGACTGTAAGGGCAGATGCAAGTGAAGAAAATCCACAGGATTTCATAGATCCAGAAACACCTTCTGGTGATAAGAAAAAGCTTTC...

Protein

Download Protein FASTA

1058 aa · LXL04_028552|LXL04_028552|OH1004|PROTEIN

MAITNPDVSLSEEELERKKKKEEKAKEKELKRLKAAQKAEAAKLKAQQGTSSMKASKKKTVRADASEENPQDFIDPETPSGDKKKLSQQMAKQFSPDAVEKSWYAWWEQSGFFEANSSSSKPPFTIVLPPPNVTGALHIGHALTAAIQDTIIRWRRMSGYNTLWVPGMDHAGIATQVVVEKKIMRERKMTRHDVGREKFVAEVWKWKEEYGGTILKQLRRLGASLDWSRECFTMDEKRSNAVTEAFVRLYKEGLIYRDLR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028552`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028552

Location Chr06:45386407-45391657 (+)

Description Similar to TWN2: Valine--tRNA ligase, mitochondrial 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g14610`	Required for embryo development and seed viability.	Suspensor-derived polyembryony caused by altered expression of valyl-tRNA synthetase in the twn2 mutant of Arabidopsis.1997 · DOI: 10.1073/pnas.94.14.7349

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028552 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006418 tRNA aminoacylation for protein translation Biological Process

GO:0006438 valyl-tRNA aminoacylation Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0031012 extracellular matrix Cellular Component

GO:0097225 sperm midpiece Cellular Component

GO:0097228 sperm principal piece Cellular Component

KEGG gene cross-reference

ath:AT1G14610

ddi:DDB_G0277733

hsa:7407

mmu:22321

rno:25009

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.703

Rank 1 · LXL04_028552 · OH-1004

Nucleus0.213

Rank 2 · LXL04_028552 · OH-1004

Mitochondrion0.114

Rank 3 · LXL04_028552 · OH-1004

Peroxisome0.087

Rank 4 · LXL04_028552 · OH-1004

Plastid0.069

Rank 5 · LXL04_028552 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00133.29tRNA-synt_1103-725 aa

PF09334.18tRNA-synt_1g131-192 aa

PF13603.13tRNA-synt_1_2345-403 aa

PF08264.20Anticodon_1771-911 aa

PF10458.15Val_tRNA-synt_C984-1043 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028552	`PF00133.29`	tRNA-synt_1	103	725	5e-149	497.3
LXL04_028552	`PF09334.18`	tRNA-synt_1g	131	192	3.1e-14	53.3
LXL04_028552	`PF13603.13`	tRNA-synt_1_2	345	403	2e-09	38.0
LXL04_028552	`PF08264.20`	Anticodon_1	771	911	8.1e-33	114.1
LXL04_028552	`PF10458.15`	Val_tRNA-synt_C	984	1043	1.4e-06	29.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P93736`	Arabidopsis thaliana	Valine--tRNA ligase, mitochondrial 1	71.568%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card