TkA01G474380 | RubberDandelionOmics

Gene overview

TkA01G474380

Reference: TK1151 Chr: Chr01 Coordinates: 118736203-118738311 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1599 bp · TkA01G474380|TK1151|cDNA

ATGGATGACCCCGAATCAGAGGCAAGTAAGATACATAGGGAGTATTACGAAGGAGAGACTGAAGATGGTGAAGATATTGAGTCGGAGGAAGAATCAAGTGAAGACGAGAAGGCTTTCGTTGTTGATGCAGAACTAGATGACTGTGATGCTGAGGAAGGAAGCTCTCAACAGGGTGAGCTTCCATTTGATGCGTTCCTGTACGACATCTGTAACCCCCCTGTTTACAATGACACTGAAACTCAGGATGGGGAAGCTATTAG...

CDS

Download CDS FASTA

1599 bp · TkA01G474380|TK1151|CDS

ATGGATGACCCCGAATCAGAGGCAAGTAAGATACATAGGGAGTATTACGAAGGAGAGACTGAAGATGGTGAAGATATTGAGTCGGAGGAAGAATCAAGTGAAGACGAGAAGGCTTTCGTTGTTGATGCAGAACTAGATGACTGTGATGCTGAGGAAGGAAGCTCTCAACAGGGTGAGCTTCCATTTGATGCGTTCCTGTACGACATCTGTAACCCCCCTGTTTACAATGACACTGAAACTCAGGATGGGGAAGCTATTAG...

Protein

Download Protein FASTA

532 aa · TkA01G474380|TK1151|PROTEIN

MDDPESEASKIHREYYEGETEDGEDIESEEESSEDEKAFVVDAELDDCDAEEGSSQQGELPFDAFLYDICNPPVYNDTETQDGEAIREEGLSDKEWEDSDDDHCDKEYGVHDPSVHWKLMKPHLGEMFVSQEELRFCLTNYAVRNGYAIKITKSSSERLQAKCGFIRGCKFFGLQAGGGLTIISDQHKGLLKAAKEVLPAVEHRQCARHVYANYKKAYAGVDFKKLFWATSMSTTESAFVGTMEELKDLNQAAYDHLMVR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G474380`
TK1151 ID	TkA01G474380
OH-1004 ID	LXL04_002213
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	90.200
Protein coverage (%)	TK1151 100.000 / OH-1004 54.817 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G474380`
Location	Chr01:118736203-118738311 (+)
Description	Similar to GLO4: Peroxisomal (S)-2-hydroxy-acid oxidase GLO4
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_002213` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006631 fatty acid metabolic process Biological Process GO:0009853 photorespiration Biological Process GO:0009854 oxidative photosynthetic carbon pathway Biological Process GO:0010109 regulation of photosynthesis Biological Process GO:0042742 defense response to bacterium Biological Process GO:0046718 symbiont entry into host cell Biological Process GO:0050665 hydrogen peroxide biosynthetic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0005777 peroxisome Cellular Component GO:0009507 chloroplast Cellular Component GO:0003973 (S)-2-hydroxy-acid oxidase activity Molecular Function GO:0010181 FMN binding Molecular Function
KEGG gene cross-reference	ath:AT3G14130 ath:AT3G14150 ath:AT4G18360 dosa:Os07g0616500 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.885

Rank 1 · TkA01G474380 · TK1151

Cytoplasm0.219

Rank 2 · TkA01G474380 · TK1151

Cell membrane0.025

Rank 3 · TkA01G474380 · TK1151

Mitochondrion0.023

Rank 4 · TkA01G474380 · TK1151

Endoplasmic reticulum0.017

Rank 5 · TkA01G474380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03108DBD_Tnp_Mut123-171 aa

PF10551MULE181-213 aa

PF00872Transposase_mut181-216 aa

PF04434SWIM365-392 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G474380	`PF03108`	DBD_Tnp_Mut	123	171	8e-05	22.9
TkA01G474380	`PF10551`	MULE	181	213	1.2e-05	26.3
TkA01G474380	`PF00872`	Transposase_mut	181	216	0.00035	20.3
TkA01G474380	`PF04434`	SWIM	365	392	9.6e-08	32.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card