TkA01G467260 | RubberDandelionOmics

Gene overview

TkA01G467260

Reference: TK1151 Chr: Chr01 Coordinates: 117005461-117010042 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3636 bp · TkA01G467260|TK1151|cDNA

AACTTCCACTTATTCGTTCAATTGGAAATTGCGGTGGATAAACAGCTATGTCAATCAATGATCTGAAAATCGCTGGAACCCTAATAGAACGCATAAAAGTAGGTCTGGAAATAGGCGGTCCTTTTTCTGTACGCTAGATTTGTTACACGATGACTTCAATTATGTATTCACTACTACTCTTTGAAGACGAACGCATGAATGGTTATCAGGAGGGGATTTTTCTACATTTTGGCAATCGATCTCCGATCTGCGACCTTCGA...

CDS

Download CDS FASTA

2589 bp · TkA01G467260|TK1151|CDS

ATGGATAGACATTCCGTACGTAGAGAGGTGCTTTCAAGAATATTGGAACGAGTCAAACCAAAGCGTATACCCAGAAATTCGGTGGAGATATTAACAAATGTGGAACTCAGCAGGATGATGGAAATGAGACACAACATACGTAACATGTCTGTTATTGGTGATATCGCTGCCGGGAAGTCTAGATTGATTGATTCTCTTGTGGCTGCTGCTGGTGTCATCGGCCAAGAAGCTGGCCATTTCACGGACACCCGTGATGATGA...

Protein

Download Protein FASTA

862 aa · TkA01G467260|TK1151|PROTEIN

MDRHSVRREVLSRILERVKPKRIPRNSVEILTNVELSRMMEMRHNIRNMSVIGDIAAGKSRLIDSLVAAAGVIGQEAGHFTDTRDDEIEQGITIKSTSTSLCYKMTEESLKGFRGERNGNKYLINLVDSPGHIELSSEVTAALRVTDGALLVVDCIDGVQLQTESLLSQVYRERVVPVLTINKIDICFSELQVDGEEAYNSFQKVIASVNDNIVCRVDPLLGDCRVYPERGGVAFSSGFFGWAFTLPYFIKKYASRFGVE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G467260`
TK1151 ID	TkA01G467260
OH-1004 ID	LXL04_037178
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	53.700
Protein coverage (%)	TK1151 96.172 / OH-1004 90.194 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G467260

Location Chr01:117005461-117010042 (+)

Description Similar to LOS1: Elongation factor 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q9ASR1`	Catalyzes the GTP-dependent ribosomal translocation step during translation elongation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037178 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002182 cytoplasmic translational elongation Biological Process

GO:0006414 translational elongation Biological Process

GO:0009409 response to cold Biological Process

GO:0009631 cold acclimation Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G56070

bvg:104906141

ncr:NCU07700

spo:2539544

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.604

Rank 1 · TkA01G467260 · TK1151

Nucleus0.273

Rank 2 · TkA01G467260 · TK1151

Mitochondrion0.115

Rank 3 · TkA01G467260 · TK1151

Cell membrane0.044

Rank 4 · TkA01G467260 · TK1151

Lysosome / Vacuole0.026

Rank 5 · TkA01G467260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00009GTP_EFTU45-244 aa

PF13191AAA_1647-173 aa

PF01926MMR_HSR149-181 aa

PF13561adh_short_C259-108 aa

PF03811Zn_ribbon_InsA360-377 aa

PF22042EF-G_D2402-488 aa

PF03144GTP_EFTU_D2415-486 aa

PF14492EFG_III511-573 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G467260	`PF00009`	GTP_EFTU	45	244	3.5e-36	125.3
TkA01G467260	`PF13191`	AAA_16	47	173	0.13	13.5
TkA01G467260	`PF01926`	MMR_HSR1	49	181	8.6e-05	23.3
TkA01G467260	`PF13561`	adh_short_C2	59	108	0.17	12.1
TkA01G467260	`PF03811`	Zn_ribbon_InsA	360	377	0.17	12.3
TkA01G467260	`PF22042`	EF-G_D2	402	488	2e-07	31.7
TkA01G467260	`PF03144`	GTP_EFTU_D2	415	486	1.7e-12	48.3
TkA01G467260	`PF14492`	EFG_III	511	573	2.2e-06	28.3
TkA01G467260	`PF03764`	EFG_IV	585	596	2.2e-05	24.9
TkA01G467260	`PF03764`	EFG_IV	640	719	2.2e-05	24.9
TkA01G467260	`PF00679`	EFG_C	742	828	8.3e-14	52.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ASR1`	Arabidopsis thaliana	sp\|Q9ASR1\|EF2_ARATH Elongation factor 2	52.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card