LXL04_037178 | RubberDandelionOmics

Gene overview

LXL04_037178

Reference: OH-1004 Chr: Chr09 Coordinates: 1076271-1080320 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2787 bp · LXL04_037178|LXL04_037178|OH1004|cDNA

ATGTCTAAGACAAATGTGAGACCAAAGCAAAGGGTCTCTGAGAGCTCATCAAATTCTGCCGCCGCTCCTTCCCCTTCTCCTTCTTTACTAGGATTTCTCTTAAAAGCAATCAAACTACACTTCTGTTGTAGTCACTCAAAATCCAGTCAAAATGGTAAATCATCCTTTCATTCTGAACTTCTTTTTCCCTTTTCCTTTCTTATGTATCATGTGTTGCCAACAATACTTACATCTCCAAATCCCTTTTCAATCCAACAGGT...

CDS

Download CDS FASTA

2787 bp · LXL04_037178|LXL04_037178|OH1004|CDS

ATGTCTAAGACAAATGTGAGACCAAAGCAAAGGGTCTCTGAGAGCTCATCAAATTCTGCCGCCGCTCCTTCCCCTTCTCCTTCTTTACTAGGATTTCTCTTAAAAGCAATCAAACTACACTTCTGTTGTAGTCACTCAAAATCCAGTCAAAATGGTAAATCATCCTTTCATTCTGAACTTCTTTTTCCCTTTTCCTTTCTTATGTATCATGTGTTGCCAACAATACTTACATCTCCAAATCCCTTTTCAATCCAACAGGT...

Protein

Download Protein FASTA

928 aa · LXL04_037178|LXL04_037178|OH1004|PROTEIN

MSKTNVRPKQRVSESSSNSAAAPSPSPSLLGFLLKAIKLHFCCSHSKSSQNGKSSFHSELLFPFSFLMYHVLPTILTSPNPFSIQQVKFTAEELRRIMDYKHNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTRADEAERGITIKSTGISLYYEMTDAALKAFKGERNGNEYLINLIDSPGHVDFSSEVTAALRITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVDGEEAY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037178`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037178

Location Chr09:1076271-1080320 (+)

Description Similar to LOS1: Elongation factor 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q9ASR1`	Catalyzes the GTP-dependent ribosomal translocation step during translation elongation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037178 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002182 cytoplasmic translational elongation Biological Process

GO:0006414 translational elongation Biological Process

GO:0009409 response to cold Biological Process

GO:0009631 cold acclimation Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G56070

bvg:104906141

ncr:NCU07700

spo:2539544

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.508

Rank 1 · LXL04_037178 · OH-1004

Nucleus0.206

Rank 2 · LXL04_037178 · OH-1004

Mitochondrion0.162

Rank 3 · LXL04_037178 · OH-1004

Cell membrane0.089

Rank 4 · LXL04_037178 · OH-1004

Endoplasmic reticulum0.046

Rank 5 · LXL04_037178 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00009.34GTP_EFTU103-306 aa

PF22042.3EF-G_D2464-554 aa

PF03144.32GTP_EFTU_D2479-547 aa

PF14492.13EFG_III572-634 aa

PF03764.25EFG_IV692-807 aa

PF00679.31EFG_C809-896 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037178	`PF00009.34`	GTP_EFTU	103	306	1.6e-48	165.5
LXL04_037178	`PF22042.3`	EF-G_D2	464	554	4e-06	27.6
LXL04_037178	`PF03144.32`	GTP_EFTU_D2	479	547	2.7e-09	38.0
LXL04_037178	`PF14492.13`	EFG_III	572	634	5.3e-12	46.4
LXL04_037178	`PF03764.25`	EFG_IV	692	807	1.8e-29	102.7
LXL04_037178	`PF00679.31`	EFG_C	809	896	1.6e-20	73.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ASR1`	Arabidopsis thaliana	Elongation factor 2	92.399%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card