TkA01G463050 | RubberDandelionOmics

Gene overview

TkA01G463050

Reference: TK1151 Chr: Chr01 Coordinates: 116045891-116048094 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1090 bp · TkA01G463050|TK1151|cDNA

CTTTACTCAACGATTCCACCCTATATTGCTTCTGGTGTCGTCAGTCGTCGGAAGTGGTTCTTACCAAGTACCAATACTTTCTCTTGCTCCATCATGGACTTCAGCCGGTTCGCTGTCGCATTCATCCTCCTCTCATTCGCTACTAATTCCTTATCGGAACGATTAATCCGTATGCCAACCGAAGATCGAGGAGTGTCAGTCCACTCTGGTGTCCCAAGTTCTCGTAAAAATCAGGATTTGCTGTGTGAAAGCTGGAAGTT...

CDS

Download CDS FASTA

885 bp · TkA01G463050|TK1151|CDS

CTTTACTCAACGATTCCACCCTATATTGCTTCTGGTGTCGTCAGTCGTCGGAAGTGGTTCTTACCAAGTACCAATACTTTCTCTTGCTCCATCATGGACTTCAGCCGGTTCGCTGTCGCATTCATCCTCCTCTCATTCGCTACTAATTCCTTATCGGAACGATTAATCCGTATGCCAACCGAAGATCGAGGAGTGTCAGTCCACTCTGGTGTCCCAAGTTCTCGTAAAAATCAGGATTTGCTGTGTGAAAGCTGGAAGTT...

Protein

Download Protein FASTA

294 aa · TkA01G463050|TK1151|PROTEIN

LYSTIPPYIASGVVSRRKWFLPSTNTFSCSIMDFSRFAVAFILLSFATNSLSERLIRMPTEDRGVSVHSGVPSSRKNQDLLCESWKFSVETNDAGVWYTVPEKCVTFVTEYLNGERYRSDSEVIADYALEYAKTVNIAGDGKDAWIFDIDETLLSNMPWYASHGFGSEVFDEVSFNEWVDVAEAPALPASLRLYTQLQQLGFKIFLLTGRSESQRECTDKNLLYSGYTNYQSLILRGSSDVGKTATLYKSERRQELLNEG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G463050`
TK1151 ID	TkA01G463050
OH-1004 ID	LXL04_002476
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.300
Protein coverage (%)	TK1151 100.000 / OH-1004 82.353 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G463050

Location Chr01:116045891-116048094 (+)

Description Similar to APS1: Acid phosphatase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g24780`	May function as somatic storage protein during early seedling development.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002476 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003993 acid phosphatase activity Molecular Function

GO:0045735 nutrient reservoir activity Molecular Function

KEGG gene cross-reference

ath:AT5G24780

gmx:547820

gmx:547821

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.357

Rank 1 · TkA01G463050 · TK1151

Endoplasmic reticulum0.242

Rank 2 · TkA01G463050 · TK1151

Cytoplasm0.178

Rank 3 · TkA01G463050 · TK1151

Golgi apparatus0.173

Rank 4 · TkA01G463050 · TK1151

Extracellular0.136

Rank 5 · TkA01G463050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03767Acid_phosphat_B74-292 aa

PF00702Hydrolase143-158 aa

PF11019DUF2608144-156 aa

PF25109HAD_PNKP144-263 aa

PF00702Hydrolase184-216 aa

PF11019DUF2608193-223 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G463050	`PF03767`	Acid_phosphat_B	74	292	8.8e-79	264.9
TkA01G463050	`PF00702`	Hydrolase	143	158	0.2	12.7
TkA01G463050	`PF11019`	DUF2608	144	156	0.24	11.6
TkA01G463050	`PF25109`	HAD_PNKP	144	263	0.28	12.0
TkA01G463050	`PF00702`	Hydrolase	184	216	0.2	12.7
TkA01G463050	`PF11019`	DUF2608	193	223	0.24	11.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49195`	Arabidopsis thaliana	sp\|O49195\|VSP1_ARATH Vegetative storage protein 1	38.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card