LXL04_002476 | RubberDandelionOmics

Gene overview

LXL04_002476

Reference: OH-1004 Chr: Chr01 Coordinates: 49538442-49541102 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1074 bp · LXL04_002476|LXL04_002476|OH1004|cDNA

ATGAAGGAGATGGTTTTGAAGAGTTCCGTAACTAAGGAGGTGATTTCTCAAGGGCTTGAAGGCTTTGGAAGCAAATTGGATGGTGGGTTGACTCTTTTTGTGGGAAAGAAACCTTCTCTCAAGCAAAAAAGAATTGTTAATGAATTGCAAATTGTATATTTGAAGAATAGTCAAGGGACAAAAGTTGTACTTTACTCAACGATTCCACCCTATATTGCTTCTGGTGTCGTCAGTCGTCGGAAGTGGTTCTTACCAAGTAC...

CDS

Download CDS FASTA

1074 bp · LXL04_002476|LXL04_002476|OH1004|CDS

ATGAAGGAGATGGTTTTGAAGAGTTCCGTAACTAAGGAGGTGATTTCTCAAGGGCTTGAAGGCTTTGGAAGCAAATTGGATGGTGGGTTGACTCTTTTTGTGGGAAAGAAACCTTCTCTCAAGCAAAAAAGAATTGTTAATGAATTGCAAATTGTATATTTGAAGAATAGTCAAGGGACAAAAGTTGTACTTTACTCAACGATTCCACCCTATATTGCTTCTGGTGTCGTCAGTCGTCGGAAGTGGTTCTTACCAAGTAC...

Protein

Download Protein FASTA

357 aa · LXL04_002476|LXL04_002476|OH1004|PROTEIN

MKEMVLKSSVTKEVISQGLEGFGSKLDGGLTLFVGKKPSLKQKRIVNELQIVYLKNSQGTKVVLYSTIPPYIASGVVSRRKWFLPSTNTFSCSIMDFSRFAVAFILLSFATNSLSERLIRMPTEDRGVSVHSGVPSSRKNQDLLCESWKFSVETNDAGVWYTVPEKCVTFVTEYLNGERYRSDSEVIADYALEYAKTVNIAGDGKDAWIFDIDETLLSNMPWYASHGFGSEVFDEVSFNEWVDVAEAPALPASLRLYTQL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002476`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002476

Location Chr01:49538442-49541102 (-)

Description Similar to APS1: Acid phosphatase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g24780`	May function as somatic storage protein during early seedling development.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002476 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003993 acid phosphatase activity Molecular Function

GO:0045735 nutrient reservoir activity Molecular Function

KEGG gene cross-reference

ath:AT5G24780

gmx:547820

gmx:547821

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.286

Rank 1 · LXL04_002476 · OH-1004

Lysosome / Vacuole0.230

Rank 2 · LXL04_002476 · OH-1004

Golgi apparatus0.213

Rank 3 · LXL04_002476 · OH-1004

Cytoplasm0.167

Rank 4 · LXL04_002476 · OH-1004

Extracellular0.108

Rank 5 · LXL04_002476 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03767.21Acid_phosphat_B137-355 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002476	`PF03767.21`	Acid_phosphat_B	137	355	5.8e-78	262.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49195`	Arabidopsis thaliana	Vegetative storage protein 1	38.318%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card