TkA01G461750 | RubberDandelionOmics

Gene overview

TkA01G461750

Reference: TK1151 Chr: Chr01 Coordinates: 115720893-115729493 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1554 bp · TkA01G461750|TK1151|cDNA

TTTTGAAAAAACTTATGTTTCACTCTAAATTTTTTTTACAGAAAATAAGAGTGTACAAGATAATATGACCAAAATTCCTGTTTTATTATTGGATAAGACAATGAGAAGAATCGAGACACTCTTTCATTCAGTCTTCCACTTCCACTTCCACTTCCAGTCCTCTATCCTCCCCAACTCCGTCGCCGCCGGTCTCCGCCGCACCATGGCTACCAACGCCCAAACCATCACTCCATCAAACACCCGTCTCGGATGGATTGGCA...

CDS

Download CDS FASTA

1065 bp · TkA01G461750|TK1151|CDS

ATGACCAAAATTCCTGTTTTATTATTGGATAAGACAATGAGAAGAATCGAGACACTCTTTCATTCAGTCTTCCACTTCCACTTCCACTTCCAGTCCTCTATCCTCCCCAACTCCGTCGCCGCCGGTCTCCGCCGCACCATGGCTACCAACGCCCAAACCATCACTCCATCAAACACCCGTCTCGGATGGATTGGCACCGGCGTCATGGGCCAATCGATGTGCTCTCACCTGATCAAAGCCGGCTACACTCTCACCATCTT...

Protein

Download Protein FASTA

354 aa · TkA01G461750|TK1151|PROTEIN

MTKIPVLLLDKTMRRIETLFHSVFHFHFHFQSSILPNSVAAGLRRTMATNAQTITPSNTRLGWIGTGVMGQSMCSHLIKAGYTLTIFTRTQSKAQPLLDIGAHWASSPHSVASQSDVVFSIVGYPSDVRHVLLHPTSGALSGLAPNGILVDMTTSEPSLAIEISNSAAEKSCFSVDAPVSGGDRGARNAALSIFAGGDESTVKRLNPIFTLLGKVNYMGGPGKGQFAKLANQITIASTMVGLIEGMIYAHKAGLDLPLYL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G461750`
TK1151 ID	TkA01G461750
OH-1004 ID	LXL04_002487
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 96.328 / OH-1004 99.706 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G461750

Location Chr01:115720893-115729493 (+)

Description Similar to At4g29120: Probable 3-hydroxyisobutyrate dehydrogenase-like 1, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g29120`	Probable 3-hydroxyisobutyrate dehydrogenase-like 1, mitochondrial.	No verified direct reference in this release
`At1g71180`	Probable 3-hydroxyisobutyrate dehydrogenase-like 3, mitochondrial.	No verified direct reference in this release
`At1g71170`	Probable 3-hydroxyisobutyrate dehydrogenase-like 2, mitochondrial.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002487 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006574 L-valine catabolic process Biological Process

GO:0016054 organic acid catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0045121 membrane raft Cellular Component

GO:0008442 3-hydroxyisobutyrate dehydrogenase activity Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0050661 NADP binding Molecular Function

GO:0051287 NAD binding Molecular Function

KEGG gene cross-reference

ath:AT1G71170

ath:AT1G71180

ath:AT4G29120

bsu:BSU13960

pcl:Pcal_0699

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.320

Rank 1 · TkA01G461750 · TK1151

Mitochondrion0.309

Rank 2 · TkA01G461750 · TK1151

Plastid0.222

Rank 3 · TkA01G461750 · TK1151

Peroxisome0.188

Rank 4 · TkA01G461750 · TK1151

Nucleus0.104

Rank 5 · TkA01G461750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12401FhaA_N11-58 aa

PF028262-Hacid_dh_C52-132 aa

PF01488Shikimate_DH57-121 aa

PF03446NAD_binding_261-217 aa

PF03807F420_oxidored61-122 aa

PF027373HCDH_N62-95 aa

PF02558ApbA64-108 aa

PF14833NAD_binding_11222-339 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G461750	`PF12401`	FhaA_N	11	58	0.083	14.0
TkA01G461750	`PF02826`	2-Hacid_dh_C	52	132	9.7e-05	22.5
TkA01G461750	`PF01488`	Shikimate_DH	57	121	0.0001	23.1
TkA01G461750	`PF03446`	NAD_binding_2	61	217	7.1e-45	153.6
TkA01G461750	`PF03807`	F420_oxidored	61	122	6.5e-06	27.4
TkA01G461750	`PF02737`	3HCDH_N	62	95	0.17	12.5
TkA01G461750	`PF02558`	ApbA	64	108	0.15	12.4
TkA01G461750	`PF14833`	NAD_binding_11	222	339	1.7e-34	119.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZE1`	Arabidopsis thaliana	sp\|Q9SZE1\|3HID1_ARATH Probable 3-hydroxyisobutyrate dehydrogenase-like 1, mitochondrial	76.300%	Swiss-Prot	High
`Q949M8`	Arabidopsis thaliana	sp\|Q949M8\|3HID3_ARATH Probable 3-hydroxyisobutyrate dehydrogenase-like 3, mitochondrial	48.300%	Swiss-Prot	Medium
`Q9C991`	Arabidopsis thaliana	sp\|Q9C991\|3HID2_ARATH Probable 3-hydroxyisobutyrate dehydrogenase-like 2, mitochondrial	46.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card