LXL04_002487 | RubberDandelionOmics

Gene overview

LXL04_002487

Reference: OH-1004 Chr: Chr01 Coordinates: 49875071-49876093 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1023 bp · LXL04_002487|LXL04_002487|OH1004|cDNA

ATGAGAAGAATCGAGACACTCTTTCATTCAGTCTTCCACTTCCACTTCCAGTCCTCTATCCTCCCCAACTCCGTCGCCGCCGGTCTCCGCCGCACCATGGCTACCAACGCCCAAACCATCACTCCATCAAACACCCGTCTCGGATGGATTGGCACCGGCGTCATGGGCCAATCGATGTGCTCTCACCTGATCAAAGCCGGCTACACTCTCACCATCTTCACCCGTACCCAATCCAAAGCCCAACCCCTCCTTGACATCGG...

CDS

Download CDS FASTA

1023 bp · LXL04_002487|LXL04_002487|OH1004|CDS

ATGAGAAGAATCGAGACACTCTTTCATTCAGTCTTCCACTTCCACTTCCAGTCCTCTATCCTCCCCAACTCCGTCGCCGCCGGTCTCCGCCGCACCATGGCTACCAACGCCCAAACCATCACTCCATCAAACACCCGTCTCGGATGGATTGGCACCGGCGTCATGGGCCAATCGATGTGCTCTCACCTGATCAAAGCCGGCTACACTCTCACCATCTTCACCCGTACCCAATCCAAAGCCCAACCCCTCCTTGACATCGG...

Protein

Download Protein FASTA

340 aa · LXL04_002487|LXL04_002487|OH1004|PROTEIN

MRRIETLFHSVFHFHFQSSILPNSVAAGLRRTMATNAQTITPSNTRLGWIGTGVMGQSMCSHLIKAGYTLTIFTRTQSKAQPLLDIGAHWASSPHSVASQSDVVFSIVGYPSDVRHVLLHPTSGALSGLAPNGILVDMTTSEPSLAIEISNSAAEKSCFSVDAPVSGGDRGARNAALSIFAGGDESTVKRLNPIFTLLGKVNYMGGPGKGQFAKLANQITIASTMVGLIEGMIYAHKAGLDLPLYLDAISTGAAGSKSLD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002487`
TK1151 ID	TkA01G461750
OH-1004 ID	LXL04_002487
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 96.328 / OH-1004 99.706 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002487

Location Chr01:49875071-49876093 (-)

Description Similar to At4g29120: Probable 3-hydroxyisobutyrate dehydrogenase-like 1, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g29120`	Probable 3-hydroxyisobutyrate dehydrogenase-like 1, mitochondrial.	No verified direct reference in this release
`At1g71180`	Probable 3-hydroxyisobutyrate dehydrogenase-like 3, mitochondrial.	No verified direct reference in this release
`At1g71170`	Probable 3-hydroxyisobutyrate dehydrogenase-like 2, mitochondrial.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002487 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006574 L-valine catabolic process Biological Process

GO:0016054 organic acid catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0045121 membrane raft Cellular Component

GO:0008442 3-hydroxyisobutyrate dehydrogenase activity Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0050661 NADP binding Molecular Function

GO:0051287 NAD binding Molecular Function

KEGG gene cross-reference

ath:AT1G71170

ath:AT1G71180

ath:AT4G29120

bsu:BSU13960

pcl:Pcal_0699

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.455

Rank 1 · LXL04_002487 · OH-1004

Cytoplasm0.236

Rank 2 · LXL04_002487 · OH-1004

Plastid0.206

Rank 3 · LXL04_002487 · OH-1004

Peroxisome0.119

Rank 4 · LXL04_002487 · OH-1004

Nucleus0.075

Rank 5 · LXL04_002487 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03446.22NAD_binding_247-203 aa

PF03807.24F420_oxidored47-108 aa

PF14833.12NAD_binding_11208-325 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002487	`PF03446.22`	NAD_binding_2	47	203	6.6e-45	153.8
LXL04_002487	`PF03807.24`	F420_oxidored	47	108	6e-06	27.5
LXL04_002487	`PF14833.12`	NAD_binding_11	208	325	1.6e-34	119.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZE1`	Arabidopsis thaliana	Probable 3-hydroxyisobutyrate dehydrogenase-like 1, mitochondrial	76.282%	Swiss-Prot	strong database homology
`Q949M8`	Arabidopsis thaliana	Probable 3-hydroxyisobutyrate dehydrogenase-like 3, mitochondrial	47.315%	Swiss-Prot	moderate database homology
`Q9C991`	Arabidopsis thaliana	Probable 3-hydroxyisobutyrate dehydrogenase-like 2, mitochondrial	45.973%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card