TkA01G460860 | RubberDandelionOmics

Gene overview

TkA01G460860

Reference: TK1151 Chr: Chr01 Coordinates: 115459328-115465850 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2841 bp · TkA01G460860|TK1151|cDNA

TAAATTTAGTTATGGCATATTTCAAGTCATCACTCTCATAAATACCTGCCCCGAGAGAAAAAGCACTGCATGAGCGGTGTTTTGGGACAAATTTCACGTAGCACAACCAATAAGATCATTACACGTGTATAAATTAGGGTGTCCACCAATCACATACATCAAAGTGTACAGCAAGGGTAAACCGGTAAAAATCCAATACCTTCACTGCTCCTCTTTCTCAGTCCATCTGCAGCTAGTCTTCTCTTTGTAAGCTTGATTGA...

CDS

Download CDS FASTA

2358 bp · TkA01G460860|TK1151|CDS

ATGGCGGTCCCCGTAGATGCCATTATTAAGCAATCGCCGCCGTCTTCGAGTCTGCGTTTCGCCTTCGGAAATGTCCTCGCCTTCTTCATTCTCCTGTTAATCGGAGTACTCGCATTCTCGATCCGTCTTTTCTCGGTTATTAAGTATGAAAGTGTTATTCATGAATTCGATCCTTATTTCAATTACAGAGTCACTCAGTTCCTCACAAAGAACGGGATATATGACTTCTGGAATTGGTTTGATGATCGCACCTGGTACCC...

Protein

Download Protein FASTA

785 aa · TkA01G460860|TK1151|PROTEIN

MAVPVDAIIKQSPPSSSLRFAFGNVLAFFILLLIGVLAFSIRLFSVIKYESVIHEFDPYFNYRVTQFLTKNGIYDFWNWFDDRTWYPLGRVIGGTVYPGLTLTAGTIWKVLQSLNIPLSVETVCVFTAPVFSAFAAWATYLLTKEVKGTGAGLTAAVLLAMVPSYISRSVAGSYDNEAVAIFALIFTFYLYIKTLNTGSLFYATLNSISYFYMVCSWGGYTFIINLIPMHALLCIVTGRYSSRLYIAYAPLVVLGTLLAA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G460860`
TK1151 ID	TkA01G460860
OH-1004 ID	LXL04_002502
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G460860

Location Chr01:115459328-115465850 (-)

Description Similar to STT3A: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g19690`	Catalytic subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation.	The STT3a subunit isoform of the Arabidopsis oligosaccharyltransferase controls adaptive responses to salt/osmotic stress.2003 · DOI: 10.1105/tpc.013862 Control of the pattern-recognition receptor EFR by an ER protein complex in plant immunity.2009 · DOI: 10.1038/emboj.2009.262 Receptor quality control in the endoplasmic reticulum for plant innate immunity.2009 · DOI: 10.1038/emboj.2009.263
`At1g34130`	Catalytic subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0519900`	Catalytic subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation.	No verified direct reference in this release
`Os04g0675500`	Catalytic subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002502 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006487 protein N-linked glycosylation Biological Process

GO:0009101 glycoprotein biosynthetic process Biological Process

GO:0009651 response to salt stress Biological Process

GO:0043687 post-translational protein modification Biological Process

GO:0047484 regulation of response to osmotic stress Biological Process

GO:0180058 protein co-translational transfer of dolichol-linked oligosaccharide Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0008250 oligosaccharyltransferase complex Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT5G19690

bta:507815

ddi:DDB_G0285159

dosa:Os05g0519900

mmu:16430

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.829

Rank 1 · TkA01G460860 · TK1151

Golgi apparatus0.100

Rank 2 · TkA01G460860 · TK1151

Cytoplasm0.078

Rank 3 · TkA01G460860 · TK1151

Nucleus0.071

Rank 4 · TkA01G460860 · TK1151

Cell membrane0.048

Rank 5 · TkA01G460860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02516STT325-428 aa

PF22627AglB_core-like60-85 aa

PF22627AglB_core-like567-644 aa

PF12626PolyA_pol_arg_C568-608 aa

PF21436STT3-PglB_core583-642 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G460860	`PF02516`	STT3	25	428	3.2e-104	350.4
TkA01G460860	`PF22627`	AglB_core-like	60	85	0.0022	19.1
TkA01G460860	`PF22627`	AglB_core-like	567	644	0.0022	19.1
TkA01G460860	`PF12626`	PolyA_pol_arg_C	568	608	0.36	11.6
TkA01G460860	`PF21436`	STT3-PglB_core	583	642	5.7e-05	24.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93ZY3`	Arabidopsis thaliana	sp\|Q93ZY3\|STT3A_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A	85.100%	Swiss-Prot	High
`Q9FX21`	Arabidopsis thaliana	sp\|Q9FX21\|STT3B_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B	61.300%	Swiss-Prot	High
`Q6F2Z1`	Oryza sativa subsp. japonica	sp\|Q6F2Z1\|STT3A_ORYSJ Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A	79.800%	Swiss-Prot	High
`Q7XQ88`	Oryza sativa subsp. japonica	sp\|Q7XQ88\|STT3B_ORYSJ Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B	52.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card