RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G449500
Reference: TK1151 Chr: Chr01 Coordinates: 112616970-112620686 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1687 bp · TkA01G449500|TK1151|cDNA

AAGTAATCAGCTAAATGTTTCATCCAATTTTCCACGGTCATCACCAACCCCATTCAGTTTCTTGAGTTCTACCAAACCTAAAAAGTTTCCATATGTTTATACAAAACTTGTATGACAAACCCCACTCTCTACTTATAGAAAATTAAAGTATTATCCTTTCTTTTTACAATTCAATGCTGCGTAATTAAAAAATTAGTACGGCAAAATTGTGCTGTGGAAAACCCCTTTTGGTTTTCATTTGGGGAAGACGACTTCGCAAA...

CDS

Download CDS FASTA

1065 bp · TkA01G449500|TK1151|CDS

ATGAATAAGGGAAATTTGGCCCCTTTTCTTAAGTTAAATCTCCCTCCACCTGATGAAACTTCTCTTGCTAAATTCTTGACTGAATCTGGGACGTTTATGGATGGTGATCTGCTAGTGAACAGGGATGGTGTTCGAATTGTTTCTCAAAGCCAATCGGAGACTCCACCTCTAATTCAGCCCTCAGACAACCAATTAAGCTTAGCCGATTTTGATGCGGTTAAAGTCGTTGGAAAGGGTAATGGTGGAATCGTTCGATTGGT...

Protein

Download Protein FASTA

354 aa · TkA01G449500|TK1151|PROTEIN

MNKGNLAPFLKLNLPPPDETSLAKFLTESGTFMDGDLLVNRDGVRIVSQSQSETPPLIQPSDNQLSLADFDAVKVVGKGNGGIVRLVRHKWTEQFFALKVIQMNVEESARKQIAQELKINQSSQCPNVVVCYQSFYDNGAVSIILEYMDGGSLADFLKTVRSIPEPYLAAISKQVLRGLWYLHHEKHIIHRDLKPSNLLINHQGDVKITDFGVSAILASTSGLANTFVGTYNYMSPERIIGGSYGYKSDIWSLGLVLLEC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G449500
TK1151 IDTkA01G449500
OH-1004 IDLXL04_002378
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G449500
LocationChr01:112616970-112620686 (-)
DescriptionSimilar to MKK2: Mitogen-activated protein kinase kinase 2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g29810 MEKK1, MKK1/MKK2 and MPK4 function in a signaling pathway that modulates the expression of genes responding to biotic and abiotic stresses and also plays an important role in pathogen defense by negatively regulating innate immunity.
The MKK2 pathway mediates cold and salt stress signaling in Arabidopsis.2004 · DOI: 10.1016/j.molcel.2004.06.023
The MAP kinase kinase MKK2 affects disease resistance in Arabidopsis.2007 · DOI: 10.1094/mpmi-20-5-0589
Arabidopsis mitogen-activated protein kinase kinases MKK1 and MKK2 have overlapping functions in defense signaling mediated by MEKK1, MPK4, and MKS1.2008 · DOI: 10.1104/pp.108.120006
At4g26070 MEKK1, MKK1/MKK2 and MPK4/MPK6 function in a signaling pathway that modulates the expression of genes responding to biotic and abiotic stresses and also plays an important role in pathogen defense by negatively regulating innate immunity.
ATMPK4, an Arabidopsis homolog of mitogen-activated protein kinase, is activated in vitro by AtMEK1 through threonine phosphorylation.2000 · DOI: 10.1104/pp.122.4.1301
The Arabidopsis MAP kinase kinase MKK1 participates in defence responses to the bacterial elicitor flagellin.2006 · DOI: 10.1111/j.1365-313x.2006.02888.x
AtMEK1 mediates stress-induced gene expression of CAT1 catalase by triggering H2O2 production in Arabidopsis.2007 · DOI: 10.1093/jxb/erm144
AtMKK1 mediates ABA-induced CAT1 expression and H2O2 production via AtMPK6-coupled signaling in Arabidopsis.2008 · DOI: 10.1111/j.1365-313x.2008.03433.x
Arabidopsis mitogen-activated protein kinase kinases MKK1 and MKK2 have overlapping functions in defense signaling mediated by MEKK1, MPK4, and MKS1.2008 · DOI: 10.1104/pp.108.120006
AtMKK1 and AtMPK6 are involved in abscisic acid and sugar signaling in Arabidopsis seed germination.2009 · DOI: 10.1007/s11103-009-9503-0

Rice

Reference gene IDPossible functionPapers / DOI
Os01g0510100 Mitogen-activated protein kinase kinase 1. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_002378 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000165 MAPK cascade Biological Process
GO:0002229 defense response to oomycetes Biological Process
GO:0002237 response to molecule of bacterial origin Biological Process
GO:0006952 defense response Biological Process
GO:0007165 signal transduction Biological Process
GO:0009409 response to cold Biological Process
GO:0009414 response to water deprivation Biological Process
GO:0009611 response to wounding Biological Process
GO:0009612 response to mechanical stimulus Biological Process
GO:0009631 cold acclimation Biological Process
GO:0009651 response to salt stress Biological Process
GO:0009875 pollen-pistil interaction Biological Process
KEGG gene cross-reference
ath:AT4G26070
ath:AT4G29810
dosa:Os01g0510100
nta:107818847
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.683
Rank 1 · TkA01G449500 · TK1151
Nucleus0.531
Rank 2 · TkA01G449500 · TK1151
Cell membrane0.065
Rank 3 · TkA01G449500 · TK1151
Mitochondrion0.051
Rank 4 · TkA01G449500 · TK1151
Endoplasmic reticulum0.044
Rank 5 · TkA01G449500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase72-330 aa
PF07714PK_Tyr_Ser-Thr73-326 aa
PF14531Kinase-like73-115 aa
PF10707YrbL-PhoP_reg93-123 aa
PF01636APH117-155 aa
PF12330Haspin_kinase135-253 aa
PF03109ABC1141-217 aa
PF01163RIO1143-212 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G449500PF00069Pkinase723306.3e-70236.3
TkA01G449500PF07714PK_Tyr_Ser-Thr733261.8e-39136.3
TkA01G449500PF14531Kinase-like731156.1e-0523.1
TkA01G449500PF10707YrbL-PhoP_reg931230.05213.9
TkA01G449500PF01636APH1171550.003817.8
TkA01G449500PF12330Haspin_kinase1352530.02114.6
TkA01G449500PF03109ABC11412173.6e-0627.0
TkA01G449500PF01163RIO11432120.01515.7
TkA01G449500PF10707YrbL-PhoP_reg1692070.05213.9
TkA01G449500PF14531Kinase-like1712716.1e-0523.1
TkA01G449500PF17667Pkinase_fungal1732560.003316.9
TkA01G449500PF01636APH1762050.003817.8
TkA01G449500PF07387Seadorna_VP71762120.2311.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9S7U9Arabidopsis thalianasp|Q9S7U9|M2K2_ARATH Mitogen-activated protein kinase kinase 268.400%Swiss-ProtHigh
Q94A06Arabidopsis thalianasp|Q94A06|M2K1_ARATH Mitogen-activated protein kinase kinase 164.400%Swiss-ProtHigh
Q5QN75Oryza sativa subsp. japonicasp|Q5QN75|M2K1_ORYSJ Mitogen-activated protein kinase kinase 159.800%Swiss-ProtHigh

JBrowse

View in Genome Browser