TkA01G447320 | RubberDandelionOmics

Gene overview

TkA01G447320

Reference: TK1151 Chr: Chr01 Coordinates: 111990965-111996540 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2936 bp · TkA01G447320|TK1151|cDNA

TAGATTCCGGTGGTGGATGGAAGGGGCCCTAAACCCAAAGGTGATAGCTATTTCGTCGTCTACGGACCGTTAGATATCAGGCACATTCAATTCTCCGAATCATCAGCAAAGCGTCGGCAACTCCATTGAAAGGAAAAACCAAAAACCTCGCCGTTACGCCTCCACTCCAAAACCCTATTCTTCCAAATTTCACGTCGCAGTTGACTTGCCGGTCACAAACACTTCAAAATGTCCGGTGATGACTTCACCAGAGGTGTTGA...

CDS

Download CDS FASTA

1803 bp · TkA01G447320|TK1151|CDS

ATGGATGAAAAGGGGGAAACAGAAACTGTAGCTAAACCTGAAGATGGAGGCTTTCTAAAACCTCAAATCTTTACCTTAACCATACCACAGGTTGATGGTGGCTCAAATATTTCGTTCAAAGTAAAATGGTCCCAGAAATTAATCTACAAAGATGGTGATTTCACAATTGATATCCCCTTCAATTTCCCAGACTATGTCACACCAGCTGGAAAGAAACTCTCAAAAAAGCAAAAAATACAACTGAATGTCAACATTGGCTT...

Protein

Download Protein FASTA

600 aa · TkA01G447320|TK1151|PROTEIN

MDEKGETETVAKPEDGGFLKPQIFTLTIPQVDGGSNISFKVKWSQKLIYKDGDFTIDIPFNFPDYVTPAGKKLSKKQKIQLNVNIGLGTEVVCKIASHPLKEKNREVGKLAFLYEADVLSWSNTDFVFTYSVPTSSAFGGVFLQSPSSLSVDQREMFSLYLFPGPDFSKKVMKKEVLFVVDISGSMKGRTIEATKSAVNVALSKLDQKDSFSIMAFNDQTYLYSSTMELATKEALDNANEWIGMNFIPGGGTNMSIALDK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G447320`
TK1151 ID	TkA01G447320
OH-1004 ID	LXL04_009024
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	44.400
Protein coverage (%)	TK1151 97.833 / OH-1004 75.658 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G447320`
Location	Chr01:111990965-111996540 (+)
Description	Similar to ITIH1: Inter-alpha-trypsin inhibitor heavy chain H1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_009024` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0030198 extracellular matrix organization Biological Process GO:0030212 hyaluronan metabolic process Biological Process GO:0034097 response to cytokine Biological Process GO:0005576 extracellular region Cellular Component GO:0005615 extracellular space Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005886 plasma membrane Cellular Component GO:0031012 extracellular matrix Cellular Component GO:0004867 serine-type endopeptidase inhibitor activity Molecular Function GO:0005540 hyaluronic acid binding Molecular Function GO:0030246 carbohydrate binding Molecular Function
KEGG gene cross-reference	hsa:127731 mmu:16424 mmu:16427 mmu:75718 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.271

Rank 1 · TkA01G447320 · TK1151

Cell membrane0.254

Rank 2 · TkA01G447320 · TK1151

Extracellular0.204

Rank 3 · TkA01G447320 · TK1151

Cytoplasm0.202

Rank 4 · TkA01G447320 · TK1151

Lysosome / Vacuole0.150

Rank 5 · TkA01G447320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05762VWA_CoxE170-302 aa

PF13768VWA_3175-335 aa

PF10138vWA-TerF-like175-295 aa

PF11775CobT_C175-208 aa

PF00092VWA176-340 aa

PF13519VWA_2176-281 aa

PF30231vWA_Rv0959176-282 aa

PF11775CobT_C428-449 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G447320	`PF05762`	VWA_CoxE	170	302	1.3e-06	28.7
TkA01G447320	`PF13768`	VWA_3	175	335	2.3e-18	67.4
TkA01G447320	`PF10138`	vWA-TerF-like	175	295	4.9e-05	24.3
TkA01G447320	`PF11775`	CobT_C	175	208	0.066	13.6
TkA01G447320	`PF00092`	VWA	176	340	4.1e-13	50.6
TkA01G447320	`PF13519`	VWA_2	176	281	6.3e-12	46.8
TkA01G447320	`PF30231`	vWA_Rv0959	176	282	0.001	19.5
TkA01G447320	`PF11775`	CobT_C	428	449	0.066	13.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card