TkA01G446770 | RubberDandelionOmics

Gene overview

TkA01G446770

Reference: TK1151 Chr: Chr01 Coordinates: 111882087-111882498 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

333 bp · TkA01G446770|TK1151|cDNA

ATGTATCAAGAGAGAAGTGTCTTGCAAGTTGAGGAAGATGAAGAGGAAGATCTTAACAGAATAAAGGAGGAAAGTAGAAGACGAAGGCAGGCAATTCTTGAAAAGTACAAGACCAAGTCATTGAAACAACAAGCACCTCAATTGTTAGAGGACACAGGAGCTAAAGTCAACGATGGTCAAGGGGAATTGTCCGATAGCAACATAGGAGACACACCCTTTTCAGTTGGGAGAGCTCCTCTACAAAATGGTGTTGAAAGGGC...

CDS

Download CDS FASTA

333 bp · TkA01G446770|TK1151|CDS

ATGTATCAAGAGAGAAGTGTCTTGCAAGTTGAGGAAGATGAAGAGGAAGATCTTAACAGAATAAAGGAGGAAAGTAGAAGACGAAGGCAGGCAATTCTTGAAAAGTACAAGACCAAGTCATTGAAACAACAAGCACCTCAATTGTTAGAGGACACAGGAGCTAAAGTCAACGATGGTCAAGGGGAATTGTCCGATAGCAACATAGGAGACACACCCTTTTCAGTTGGGAGAGCTCCTCTACAAAATGGTGTTGAAAGGGC...

Protein

Download Protein FASTA

110 aa · TkA01G446770|TK1151|PROTEIN

MYQERSVLQVEEDEEEDLNRIKEESRRRRQAILEKYKTKSLKQQAPQLLEDTGAKVNDGQGELSDSNIGDTPFSVGRAPLQNGVERALGTGGLGEGTPKVCRLIIISFIV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G446770`
TK1151 ID	TkA01G446770
OH-1004 ID	LXL04_001147
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.000
Protein coverage (%)	TK1151 90.000 / OH-1004 10.808 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G446770`
Location	Chr01:111882087-111882498 (-)
Description	Similar to Prpf4b: Serine/threonine-protein kinase PRP4 homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_001147` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000244 spliceosomal tri-snRNP complex assembly Biological Process GO:0000387 spliceosomal snRNP assembly Biological Process GO:0000388 spliceosome conformational change to release U4 (or U4atac) and U1 (or U11) Biological Process GO:0000398 mRNA splicing, via spliceosome Biological Process GO:0035332 positive regulation of hippo signaling Biological Process GO:0045292 mRNA cis splicing, via spliceosome Biological Process GO:0046827 positive regulation of protein export from nucleus Biological Process GO:0090266 regulation of mitotic cell cycle spindle assembly checkpoint Biological Process GO:0000776 kinetochore Cellular Component GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005681 spliceosomal complex Cellular Component
KEGG gene cross-reference	bta:512236 hsa:8899 mmu:19134 pon:100173192 rno:291078 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.869

Rank 1 · TkA01G446770 · TK1151

Cytoplasm0.255

Rank 2 · TkA01G446770 · TK1151

Mitochondrion0.026

Rank 3 · TkA01G446770 · TK1151

Cell membrane0.019

Rank 4 · TkA01G446770 · TK1151

Endoplasmic reticulum0.010

Rank 5 · TkA01G446770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF31247HAUS83-50 aa

PF16619SUIM_assoc22-46 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G446770	`PF31247`	HAUS8	3	50	0.29	11.6
TkA01G446770	`PF16619`	SUIM_assoc	22	46	0.1	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card