TkA01G440400 | RubberDandelionOmics

Gene overview

TkA01G440400

Reference: TK1151 Chr: Chr01 Coordinates: 110039882-110044203 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3255 bp · TkA01G440400|TK1151|cDNA

ATGGATCTGGAAGACGGAGAATTTGTGCCTGCCGGAATTTTGGCTAACTCCGGCAAAAAAGATCCTTTGGCTAATAAGGGATCGTCGGAATTCCCAATCGGAAGCTTGCATGGGGGAAAGCATCGTAGCGTGGAAGTAGAGGATTCAATTCAGCATGCGAGCAATAAAATAAACGACTTGGTGGATGGAGATGTTGAGCATGCTGCAATCAATCGAGGTTGCAAAGATTCCTTGGCCCCACCTAACACCAAAAACGTCCC...

CDS

Download CDS FASTA

3255 bp · TkA01G440400|TK1151|CDS

ATGGATCTGGAAGACGGAGAATTTGTGCCTGCCGGAATTTTGGCTAACTCCGGCAAAAAAGATCCTTTGGCTAATAAGGGATCGTCGGAATTCCCAATCGGAAGCTTGCATGGGGGAAAGCATCGTAGCGTGGAAGTAGAGGATTCAATTCAGCATGCGAGCAATAAAATAAACGACTTGGTGGATGGAGATGTTGAGCATGCTGCAATCAATCGAGGTTGCAAAGATTCCTTGGCCCCACCTAACACCAAAAACGTCCC...

Protein

Download Protein FASTA

1084 aa · TkA01G440400|TK1151|PROTEIN

MDLEDGEFVPAGILANSGKKDPLANKGSSEFPIGSLHGGKHRSVEVEDSIQHASNKINDLVDGDVEHAAINRGCKDSLAPPNTKNVPNPHHVVSPPKNSLVGPFPSPITTQLCPLNPISPDFQPGTSAAKRRRTKGKDRSNSRSRSGSHGSNRPSPVRSFPSLDLNRQVSSSRISDSANHGSPTHTSASSSAELDHTVRIGNQLGFQFDKHNQAVLLAESRLNSCPVNIDYWWGHSDFDFAFVEATGRSGGLLSVWDKNL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G440400`
TK1151 ID	TkA01G440400
OH-1004 ID	LXL04_006182
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	43.300
Protein coverage (%)	TK1151 99.908 / OH-1004 44.073 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G440400

Location Chr01:110039882-110044203 (-)

Description Similar to mcd4: GPI ethanolamine phosphate transferase 1 (Aspergillus oryzae (strain ATCC 42149 / RIB 40)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g65750`	Putative ribonuclease H protein At1g65750.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006182 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006506 GPI anchor biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0051377 mannose-ethanolamine phosphotransferase activity Molecular Function

KEGG gene cross-reference

afm:AFUA_4G03970

aor:AO090011000320

hsa:23556

ncr:NCU07999

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.519

Rank 1 · TkA01G440400 · TK1151

Nucleus0.440

Rank 2 · TkA01G440400 · TK1151

Cell membrane0.102

Rank 3 · TkA01G440400 · TK1151

Lysosome / Vacuole0.035

Rank 4 · TkA01G440400 · TK1151

Endoplasmic reticulum0.032

Rank 5 · TkA01G440400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03372Exo_endo_phos240-406 aa

PF13966zf-RVT481-520 aa

PF13966zf-RVT898-981 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G440400	`PF03372`	Exo_endo_phos	240	406	7.9e-07	29.8
TkA01G440400	`PF13966`	zf-RVT	481	520	2.3e-13	51.3
TkA01G440400	`PF13966`	zf-RVT	898	981	2.3e-13	51.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0C2F6`	Arabidopsis thaliana	sp\|P0C2F6\|RNHX1_ARATH Putative ribonuclease H protein At1g65750	29.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card