TkA01G439810 | RubberDandelionOmics

Gene overview

TkA01G439810

Reference: TK1151 Chr: Chr01 Coordinates: 109880087-109881687 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1386 bp · TkA01G439810|TK1151|cDNA

ATGTACATCAGACAACGGCAGCTGTTGTATTACCGGGATGAGTTCGGTGACCGTGGAGAGAATGTGACGGTTGATCCTTCGTTGGTTTTTGAAAACCCTAGGCTGAGAAATGCTTACATTGCTTTACAAGCATGGAAGCAGGCGATACTCTCAGATCCGCTTAATCTGACCGCTGATTGGGTTGGAACTGACGTTTGTGGTGGGTACACCGGAGTGTTTTGTGCTCCGGCCCCGGATAACCGGTCTGAAAGAACCGTCGC...

CDS

Download CDS FASTA

1386 bp · TkA01G439810|TK1151|CDS

ATGTACATCAGACAACGGCAGCTGTTGTATTACCGGGATGAGTTCGGTGACCGTGGAGAGAATGTGACGGTTGATCCTTCGTTGGTTTTTGAAAACCCTAGGCTGAGAAATGCTTACATTGCTTTACAAGCATGGAAGCAGGCGATACTCTCAGATCCGCTTAATCTGACCGCTGATTGGGTTGGAACTGACGTTTGTGGTGGGTACACCGGAGTGTTTTGTGCTCCGGCCCCGGATAACCGGTCTGAAAGAACCGTCGC...

Protein

Download Protein FASTA

461 aa · TkA01G439810|TK1151|PROTEIN

MYIRQRQLLYYRDEFGDRGENVTVDPSLVFENPRLRNAYIALQAWKQAILSDPLNLTADWVGTDVCGGYTGVFCAPAPDNRSERTVAGIDLNHGDIAGYLPEELGLLTDLALFHINSNRFCGTIPKKFQKLRLLFELDISNNRFAGKFPNVVLKLPKLKFLDLRFNEFEGNVPKELFDKDLDAIFINHNRFQFELPDNFGNSPVSVIVLANNKFHGCVPASIGNMSDTLNEIIMMNNGLRSCVPAEIGMLNQVTVLDVSF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G439810`
TK1151 ID	TkA01G439810
OH-1004 ID	LXL04_002574
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.300
Protein coverage (%)	TK1151 75.705 / OH-1004 45.982 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G439810

Location Chr01:109880087-109881687 (-)

Description Similar to LRX4: Leucine-rich repeat extensin-like protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g18670`	Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization.	No verified direct reference in this release
`At3g24480`	Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization.	No verified direct reference in this release
`At4g13340`	Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization.	No verified direct reference in this release
`At1g62440`	Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization.	Synergistic interaction of the two paralogous Arabidopsis genes LRX1 and LRX2 in cell wall formation during root hair development.2003 · DOI: 10.1046/j.1365-313x.2003.01784.x
`At5g25550`	Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002574 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000902 cell morphogenesis Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010054 trichoblast differentiation Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0005199 structural constituent of cell wall Molecular Function

KEGG gene cross-reference

ath:AT1G12040

ath:AT1G49490

ath:AT3G22800

ath:AT3G24480

ath:AT4G18670

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.389

Rank 1 · TkA01G439810 · TK1151

Cell membrane0.283

Rank 2 · TkA01G439810 · TK1151

Endoplasmic reticulum0.119

Rank 3 · TkA01G439810 · TK1151

Cytoplasm0.086

Rank 4 · TkA01G439810 · TK1151

Plastid0.049

Rank 5 · TkA01G439810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_241-74 aa

PF00560LRR_189-105 aa

PF23598LRR_14104-165 aa

PF13855LRR_8111-167 aa

PF00560LRR_1113-131 aa

PF00560LRR_1134-152 aa

PF12799LRR_4136-166 aa

PF13516LRR_6136-144 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G439810	`PF08263`	LRRNT_2	41	74	0.00091	20.2
TkA01G439810	`PF00560`	LRR_1	89	105	1.2e-13	49.0
TkA01G439810	`PF23598`	LRR_14	104	165	3.1e-07	30.2
TkA01G439810	`PF13855`	LRR_8	111	167	3.4e-10	40.2
TkA01G439810	`PF00560`	LRR_1	113	131	1.2e-13	49.0
TkA01G439810	`PF00560`	LRR_1	134	152	1.2e-13	49.0
TkA01G439810	`PF12799`	LRR_4	136	166	1.4e-08	35.4
TkA01G439810	`PF13516`	LRR_6	136	144	0.89	10.5
TkA01G439810	`PF13516`	LRR_6	155	169	0.89	10.5
TkA01G439810	`PF00560`	LRR_1	157	176	1.2e-13	49.0
TkA01G439810	`PF13855`	LRR_8	181	226	3.4e-10	40.2
TkA01G439810	`PF00560`	LRR_1	184	201	1.2e-13	49.0
TkA01G439810	`PF13855`	LRR_8	205	263	3.4e-10	40.2
TkA01G439810	`PF00560`	LRR_1	206	225	1.2e-13	49.0
TkA01G439810	`PF12799`	LRR_4	208	213	1.4e-08	35.4
TkA01G439810	`PF00560`	LRR_1	229	248	1.2e-13	49.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SN46`	Arabidopsis thaliana	sp\|Q9SN46\|LRX5_ARATH Leucine-rich repeat extensin-like protein 5	80.800%	Swiss-Prot	High
`Q9LHF1`	Arabidopsis thaliana	sp\|Q9LHF1\|LRX4_ARATH Leucine-rich repeat extensin-like protein 4	68.700%	Swiss-Prot	High
`Q9T0K5`	Arabidopsis thaliana	sp\|Q9T0K5\|LRX3_ARATH Leucine-rich repeat extensin-like protein 3	66.800%	Swiss-Prot	High
`O48809`	Arabidopsis thaliana	sp\|O48809\|LRX2_ARATH Leucine-rich repeat extensin-like protein 2	61.700%	Swiss-Prot	Medium
`Q4PSE6`	Arabidopsis thaliana	sp\|Q4PSE6\|LRX7_ARATH Leucine-rich repeat extensin-like protein 7	64.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card