LXL04_002574 | RubberDandelionOmics

Gene overview

LXL04_002574

Reference: OH-1004 Chr: Chr01 Coordinates: 51938774-51941292 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2280 bp · LXL04_002574|LXL04_002574|OH1004|cDNA

ATGAAGAACATCTCTACGCATTATTTCAATCTCTTGTACTTTGTTCTGTTTGCATTATTATTTGGTCATATATTTTGTTTTCCCGATGATTACGGCGGCGGTGTGGGTGGTTCTGGTCCGCTCACTGACAGTGAGGCCATGTACATCAGACAACGGCAGCTGTTGTATTACCGGGATGAGTTCGGTGACCGTGGAGAGAATGTGACGGTTGATCCTTCGTTGGTTTTTGAAAACCCTAGGCTGAGAAATGCTTACATTGC...

CDS

Download CDS FASTA

2280 bp · LXL04_002574|LXL04_002574|OH1004|CDS

ATGAAGAACATCTCTACGCATTATTTCAATCTCTTGTACTTTGTTCTGTTTGCATTATTATTTGGTCATATATTTTGTTTTCCCGATGATTACGGCGGCGGTGTGGGTGGTTCTGGTCCGCTCACTGACAGTGAGGCCATGTACATCAGACAACGGCAGCTGTTGTATTACCGGGATGAGTTCGGTGACCGTGGAGAGAATGTGACGGTTGATCCTTCGTTGGTTTTTGAAAACCCTAGGCTGAGAAATGCTTACATTGC...

Protein

Download Protein FASTA

759 aa · LXL04_002574|LXL04_002574|OH1004|PROTEIN

MKNISTHYFNLLYFVLFALLFGHIFCFPDDYGGGVGGSGPLTDSEAMYIRQRQLLYYRDEFGDRGENVTVDPSLVFENPRLRNAYIALQAWKQAILSDPLNLTADWVGTDVCGGYTGVFCAPAPDNRSERTVAGIDLNHGDIAGYLPEELGLLTDLALFHINSNRFCGTIPKKFQKLRLLFELDISNNRFAGKFPNVVLKLPKLKFLDLRFNEFEGNVPKELFDKDLDAIFINHNRFQFELPDNFGNSPVSVIVLANNKF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002574`
TK1151 ID	TkA01G439810
OH-1004 ID	LXL04_002574
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.300
Protein coverage (%)	TK1151 75.705 / OH-1004 45.982 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002574

Location Chr01:51938774-51941292 (+)

Description Similar to LRX4: Leucine-rich repeat extensin-like protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g24480`	Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization.	No verified direct reference in this release
`At4g18670`	Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization.	No verified direct reference in this release
`At1g49490`	Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization.	No verified direct reference in this release
`At1g12040`	Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization.	The chimeric leucine-rich repeat/extensin cell wall protein LRX1 is required for root hair morphogenesis in Arabidopsis thaliana.2001 · DOI: 10.1101/gad.200201 Synergistic interaction of the two paralogous Arabidopsis genes LRX1 and LRX2 in cell wall formation during root hair development.2003 · DOI: 10.1046/j.1365-313x.2003.01784.x
`At3g22800`	Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002574 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000902 cell morphogenesis Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010054 trichoblast differentiation Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0005199 structural constituent of cell wall Molecular Function

KEGG gene cross-reference

ath:AT1G12040

ath:AT1G49490

ath:AT3G22800

ath:AT3G24480

ath:AT4G18670

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.394

Rank 1 · LXL04_002574 · OH-1004

Cell membrane0.299

Rank 2 · LXL04_002574 · OH-1004

Endoplasmic reticulum0.151

Rank 3 · LXL04_002574 · OH-1004

Cytoplasm0.073

Rank 4 · LXL04_002574 · OH-1004

Plastid0.047

Rank 5 · LXL04_002574 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13855.13LRR_8157-213 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002574	`PF13855.13`	LRR_8	157	213	2e-11	44.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LHF1`	Arabidopsis thaliana	Leucine-rich repeat extensin-like protein 4	69.544%	Swiss-Prot	moderate database homology
`Q9SN46`	Arabidopsis thaliana	Leucine-rich repeat extensin-like protein 5	69.704%	Swiss-Prot	moderate database homology
`Q9XIB6`	Arabidopsis thaliana	Pollen-specific leucine-rich repeat extensin-like protein 2	50.916%	Swiss-Prot	moderate database homology
`O65375`	Arabidopsis thaliana	Leucine-rich repeat extensin-like protein 1	54.805%	Swiss-Prot	moderate database homology
`Q9LUI1`	Arabidopsis thaliana	Leucine-rich repeat extensin-like protein 6	64.307%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card