TkA01G437440 | RubberDandelionOmics

Gene overview

TkA01G437440

Reference: TK1151 Chr: Chr01 Coordinates: 109278290-109280104 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

525 bp · TkA01G437440|TK1151|cDNA

ATGATTTTAATTTTAGCTAATTCTAATAGAATTTTTTGCGGGAAGCAGCCGAAGGAATTAGAGTATGATGTAGAAAGAAAGCCAGAGGCACCAAAGGATTATATTCATGTGAGAGCAAGAAGAGGGCAAACTACTGATAGCCATAGGTTAGCAGAGAGAGTTAGAAGGGAGAAAATCGGTGAAAGAATGAATCTTCTTCAAAATCTTGTACCAAATTGTGACAAGGTGAGGATGAAAGATGTCAATTTGATTTTTATGGG...

CDS

Download CDS FASTA

525 bp · TkA01G437440|TK1151|CDS

ATGATTTTAATTTTAGCTAATTCTAATAGAATTTTTTGCGGGAAGCAGCCGAAGGAATTAGAGTATGATGTAGAAAGAAAGCCAGAGGCACCAAAGGATTATATTCATGTGAGAGCAAGAAGAGGGCAAACTACTGATAGCCATAGGTTAGCAGAGAGAGTTAGAAGGGAGAAAATCGGTGAAAGAATGAATCTTCTTCAAAATCTTGTACCAAATTGTGACAAGGTGAGGATGAAAGATGTCAATTTGATTTTTATGGG...

Protein

Download Protein FASTA

174 aa · TkA01G437440|TK1151|PROTEIN

MILILANSNRIFCGKQPKELEYDVERKPEAPKDYIHVRARRGQTTDSHRLAERVRREKIGERMNLLQNLVPNCDKVRMKDVNLIFMGKVNPTQCEAITMVCAQAIGNHVTLTLGGSNGHSELNVFKPIISIRLLADASASFEKNCVRGIQANRDRISKLLHEVIIIINKTYNYY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G437440`
TK1151 ID	TkA01G437440
OH-1004 ID	LXL04_030627
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.800
Protein coverage (%)	TK1151 95.402 / OH-1004 75.109 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G437440

Location Chr01:109278290-109280104 (+)

Description Similar to FUM2: Fumarate hydratase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g50950`	Cytosolic fumarate hydratase that catalyzes the reversible stereospecific interconversion of fumarate to L-malate.	Arabidopsis has a cytosolic fumarase required for the massive allocation of photosynthate into fumaric acid and for rapid plant growth on high nitrogen.2010 · DOI: 10.1111/j.1365-313x.2010.04189.x FUM2, a Cytosolic Fumarase, Is Essential for Acclimation to Low Temperature in Arabidopsis thaliana.2016 · DOI: 10.1104/pp.16.00852 The complex allosteric and redox regulation of the fumarate hydratase and malate dehydratase reactions of Arabidopsis thaliana Fumarase 1 and 2 gives clues for understanding the massive accumulation of fumarate.2018 · DOI: 10.1111/febs.14483
`At2g47510`	Catalyzes the reversible stereospecific interconversion of fumarate to L-malate.	The complex allosteric and redox regulation of the fumarate hydratase and malate dehydratase reactions of Arabidopsis thaliana Fumarase 1 and 2 gives clues for understanding the massive accumulation of fumarate.2018 · DOI: 10.1111/febs.14483

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030627 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000050 urea cycle Biological Process

GO:0006099 tricarboxylic acid cycle Biological Process

GO:0006106 fumarate metabolic process Biological Process

GO:0006108 malate metabolic process Biological Process

GO:0006281 DNA repair Biological Process

GO:0006525 arginine metabolic process Biological Process

GO:0006974 DNA damage response Biological Process

GO:0009631 cold acclimation Biological Process

GO:0010109 regulation of photosynthesis Biological Process

GO:0042128 nitrate assimilation Biological Process

GO:0048868 pollen tube development Biological Process

GO:0051262 protein tetramerization Biological Process

KEGG gene cross-reference

ath:AT2G47510

ath:AT5G50950

hsa:2271

rno:24368

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.564

Rank 1 · TkA01G437440 · TK1151

Cytoplasm0.390

Rank 2 · TkA01G437440 · TK1151

Mitochondrion0.082

Rank 3 · TkA01G437440 · TK1151

Cell membrane0.055

Rank 4 · TkA01G437440 · TK1151

Endoplasmic reticulum0.035

Rank 5 · TkA01G437440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00206Lyase_144-64 aa

PF00010HLH47-72 aa

PF00206Lyase_187-106 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G437440	`PF00206`	Lyase_1	44	64	0.0021	18.2
TkA01G437440	`PF00010`	HLH	47	72	0.0082	16.7
TkA01G437440	`PF00206`	Lyase_1	87	106	0.0021	18.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FI53`	Arabidopsis thaliana	sp\|Q9FI53\|FUM2_ARATH Fumarate hydratase 2	73.300%	Swiss-Prot	Low
`P93033`	Arabidopsis thaliana	sp\|P93033\|FUM1_ARATH Fumarate hydratase 1, mitochondrial	72.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card