Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1868 bp · TkA01G434820|TK1151|cDNA
TTCTTGTATTCGAGAACCTTTATTAGGGTTTCTCAAATAAGTATTTGTGAGCTCAGTAAAAGTTTTCAGATCGTTTTCGTTCACCAAGTATTTGTGAATTTGCGCGCATATGTGGATTGAAGTGTTGGTAGACCCGATGTGGATTTGCCCAAGGACAAGGGAAATAACATGATGTACCAACCTATCCCATGAAACACGGTATTCATTTACTTGTCAAGTCCTCGAAATCAACCCAATCACTCTGCTTCGAGCGGCCCTTC...
1023 bp · TkA01G434820|TK1151|CDS
ATGGCCGTCCCGAAGCAACATTATGCTACAAGCAGTCTTGTGATTGGGTACGCTCTATGTTCAAGCTTGTTAGCTGTGATTAACAAATTTGCAATCACGAAGTTTAATTACCCAGGGCTATTGACTGCTCTGCAGTATTTAACTTCAGCATTAGGAGTTTGGGTTTTGGGAAAATTAGGGTTCTTAAGCCACGATCCGTTCGTGTGGGAAACCGCCAAGAAATTCTTACCGGCTGCCATCGTTTTCTACCTCGCAATCTT...
Protein
Download Protein FASTA340 aa · TkA01G434820|TK1151|PROTEIN
MAVPKQHYATSSLVIGYALCSSLLAVINKFAITKFNYPGLLTALQYLTSALGVWVLGKLGFLSHDPFVWETAKKFLPAAIVFYLAIFTNTNLLRHANVDTFIVFRSLTPLLVALADTTFRKQPVPSKLTFLSLLIILGGAVGYVATDSGFTLTAYSWAFAYLITITTEMVYIKHMVTNLGLNTWGFVYYNNLLSLMMAPFFWIMTGEYSDVFATVGSNHGNVFEIIAFTAVSSSCVFGLLISFFGFACRKAISATAFTVT...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G434820 |
|---|---|
| TK1151 ID | TkA01G434820 |
| OH-1004 ID | LXL04_020989 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 54.600 |
| Protein coverage (%) | TK1151 78.824 / OH-1004 86.971Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G434820 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:108604215-108606760 (+) | |||||||||
| Description | Similar to GONST3: GDP-mannose transporter GONST3 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006952 defense response Biological Process GO:0015713 phosphoglycerate transmembrane transport Biological Process GO:0015780 nucleotide-sugar transmembrane transport Biological Process GO:0015783 GDP-fucose transmembrane transport Biological Process GO:0015786 UDP-glucose transmembrane transport Biological Process GO:0035436 triose phosphate transmembrane transport Biological Process GO:0048527 lateral root development Biological Process GO:0055085 transmembrane transport Biological Process GO:0072334 UDP-galactose transmembrane transport Biological Process GO:0080147 root hair cell development Biological Process GO:1990570 GDP-mannose transmembrane transport Biological Process GO:0000138 Golgi trans cisterna Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G76340 ath:AT2G13650 ath:AT4G31600 ath:AT5G17630 ath:AT5G19980 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF03151TPT19-298 aaPF08728CRT1073-152 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G434820 | PF03151 | TPT | 19 | 298 | 9.9e-14 | 52.1 |
| TkA01G434820 | PF08728 | CRT10 | 73 | 152 | 0.25 | 10.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.