TkA01G432590 | RubberDandelionOmics

Gene overview

TkA01G432590

Reference: TK1151 Chr: Chr01 Coordinates: 108054747-108057097 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1654 bp · TkA01G432590|TK1151|cDNA

ATAAAACTTACTTTATCCGTAAAAAGCCTGTCTCCACGAATATTCATATATAAAGAGCGAAGGAGAAAACAAAATATAAGTTCAGTCTTACTCTTCTTCTTCTTCCTCTTCAAGCCATCATGGCAACTTTAACCAGAGATGAATCCGACTACGATAGTAGCTGTTCATCGATTACCGTCCCAGATTCCAGCCGGAGCTGGATGAGCAACGTCAGTTTTGGCAGCCGCCGTAGCTCCATCTCCGGCGACCCTTCCCACAAA...

CDS

Download CDS FASTA

732 bp · TkA01G432590|TK1151|CDS

ATGGCAACTTTAACCAGAGATGAATCCGACTACGATAGTAGCTGTTCATCGATTACCGTCCCAGATTCCAGCCGGAGCTGGATGAGCAACGTCAGTTTTGGCAGCCGCCGTAGCTCCATCTCCGGCGACCCTTCCCACAAACCACACAAAGCACACCAAGCCGCATGGAAGGCCATGAAGAGGCTACGGGCAGAGAAGGGTGGTCGGGTGAGTTTGGACCATTTTAAGATCTTGAAACGAGTCGGGTCCGGCGACATAGG...

Protein

Download Protein FASTA

243 aa · TkA01G432590|TK1151|PROTEIN

MATLTRDESDYDSSCSSITVPDSSRSWMSNVSFGSRRSSISGDPSHKPHKAHQAAWKAMKRLRAEKGGRVSLDHFKILKRVGSGDIGNVYLCQIRNPVVGLPNCFYAMKVVDREALAIRKKLQRAEMEKEILAGLDHPFLPTLYAEFDASHYSCLVMEFCPGGDLHAARQRQPAKCFSISSAKFYVAETLLALEYLHMMGIVYRDLKPENVLVREDGHIMLSDFDLSLKCDVVPKLIDLNRTN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G432590`
TK1151 ID	TkA01G432590
OH-1004 ID	LXL04_002653
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 97.531 / OH-1004 50.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G432590

Location Chr01:108054747-108057097 (-)

Description Similar to PID2: Protein kinase PINOID 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g26700`	Serine/threonine-protein kinase involved in the regulation of auxin signaling.	NPY genes and AGC kinases define two key steps in auxin-mediated organogenesis in Arabidopsis.2008 · DOI: 10.1073/pnas.0809761106
`At4g26610`	Protein kinase that regulates the auxin transport activity of PIN auxin efflux facilitators by direct phosphorylation.	D6PK AGCVIII kinases are required for auxin transport and phototropic hypocotyl bending in Arabidopsis.2013 · DOI: 10.1105/tpc.113.111484
`At5g47750`	Protein kinase that regulates the auxin transport activity of PIN auxin efflux facilitators by direct phosphorylation.	D6PK AGCVIII kinases are required for auxin transport and phototropic hypocotyl bending in Arabidopsis.2013 · DOI: 10.1105/tpc.113.111484
`At5g55910`	Protein kinase that regulates the auxin transport activity of PIN auxin efflux facilitators by direct phosphorylation.	The polarly localized D6 PROTEIN KINASE is required for efficient auxin transport in Arabidopsis thaliana.2009 · DOI: 10.1242/dev.028365 D6PK AGCVIII kinases are required for auxin transport and phototropic hypocotyl bending in Arabidopsis.2013 · DOI: 10.1105/tpc.113.111484 Arabidopsis D6PK is a lipid domain-dependent mediator of root epidermal planar polarity.2015 · DOI: 10.1038/nplants.2015.162

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0174700`	Serine/threonine-protein kinase involved in the regulation of auxin signaling.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002653 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0009638 phototropism Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0010540 basipetal auxin transport Biological Process

GO:0048367 shoot system development Biological Process

GO:0048608 reproductive structure development Biological Process

GO:0048825 cotyledon development Biological Process

GO:0099402 plant organ development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT2G26700

ath:AT5G47750

dosa:Os01g0174700

dosa:Os06g0291600

osa:4340792

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.592

Rank 1 · TkA01G432590 · TK1151

Nucleus0.407

Rank 2 · TkA01G432590 · TK1151

Cell membrane0.150

Rank 3 · TkA01G432590 · TK1151

Endoplasmic reticulum0.047

Rank 4 · TkA01G432590 · TK1151

Mitochondrion0.038

Rank 5 · TkA01G432590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01163RIO130-66 aa

PF03109ABC151-93 aa

PF12260PIP49_C56-126 aa

PF00069Pkinase75-229 aa

PF07714PK_Tyr_Ser-Thr76-229 aa

PF01636APH140-167 aa

PF03109ABC1141-227 aa

PF01163RIO1152-229 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G432590	`PF01163`	RIO1	30	66	0.027	14.8
TkA01G432590	`PF03109`	ABC1	51	93	0.00016	21.6
TkA01G432590	`PF12260`	PIP49_C	56	126	0.14	12.4
TkA01G432590	`PF00069`	Pkinase	75	229	4e-32	112.4
TkA01G432590	`PF07714`	PK_Tyr_Ser-Thr	76	229	8.3e-18	65.3
TkA01G432590	`PF01636`	APH	140	167	0.13	12.7
TkA01G432590	`PF03109`	ABC1	141	227	0.00016	21.6
TkA01G432590	`PF01163`	RIO1	152	229	0.027	14.8
TkA01G432590	`PF14531`	Kinase-like	194	225	0.29	11.1
TkA01G432590	`PF01636`	APH	199	225	0.13	12.7
TkA01G432590	`PF12260`	PIP49_C	205	225	0.14	12.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q64FQ2`	Arabidopsis thaliana	sp\|Q64FQ2\|PID2_ARATH Protein kinase PINOID 2	65.700%	Swiss-Prot	High
`Q9SUA3`	Arabidopsis thaliana	sp\|Q9SUA3\|D6KL1_ARATH Serine/threonine-protein kinase D6PKL1	60.400%	Swiss-Prot	High
`Q39183`	Arabidopsis thaliana	sp\|Q39183\|D6KL2_ARATH Serine/threonine-protein kinase D6PKL2	58.200%	Swiss-Prot	High
`Q9FG74`	Arabidopsis thaliana	sp\|Q9FG74\|D6PK_ARATH Serine/threonine-protein kinase D6PK	59.900%	Swiss-Prot	High
`Q94E49`	Oryza sativa subsp. japonica	sp\|Q94E49\|PID2_ORYSJ Protein kinase PINOID 2	66.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card