LXL04_002653 | RubberDandelionOmics

Gene overview

LXL04_002653

Reference: OH-1004 Chr: Chr01 Coordinates: 53932899-53935065 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1425 bp · LXL04_002653|LXL04_002653|OH1004|cDNA

ATGGCAACTTTAACCAGAGATGAATCCGACTACGATAGTAGCTGTTCATCGATTACCGTCCCAGATTCCAGCCGGAGCTGGATGAGCAACGTCAGTTTTGGCAGCCGCCGTAGCTCCATCTCCGGTGACCCTTCCCACAAACCACACAAAGCACACCAAGCCGCATGGAAGGCCATGAAGAGGCTACGGGCAGAGAAGGGTGGTCGGGTGAGCTTGGACCATTTTAAGATCTTGAAACGAGTCGGGTCCGGCGACATAGG...

CDS

Download CDS FASTA

1425 bp · LXL04_002653|LXL04_002653|OH1004|CDS

ATGGCAACTTTAACCAGAGATGAATCCGACTACGATAGTAGCTGTTCATCGATTACCGTCCCAGATTCCAGCCGGAGCTGGATGAGCAACGTCAGTTTTGGCAGCCGCCGTAGCTCCATCTCCGGTGACCCTTCCCACAAACCACACAAAGCACACCAAGCCGCATGGAAGGCCATGAAGAGGCTACGGGCAGAGAAGGGTGGTCGGGTGAGCTTGGACCATTTTAAGATCTTGAAACGAGTCGGGTCCGGCGACATAGG...

Protein

Download Protein FASTA

474 aa · LXL04_002653|LXL04_002653|OH1004|PROTEIN

MATLTRDESDYDSSCSSITVPDSSRSWMSNVSFGSRRSSISGDPSHKPHKAHQAAWKAMKRLRAEKGGRVSLDHFKILKRVGSGDIGNVYLCQIRNPVVGLPNCFYAMKVVDREALAIRKKLQRAEMEKEILAGLDHPFLPTLYAEFDASHYSCLVMEFCPGGDLHAARQRQPAKCFSISSAKFYVAETLLALEYLHMMGIVYRDLKPENVLVREDGHIMLSDFDLSLKCDVVPKLIRSKPEPSKQIDHEDDDHDLKCST...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002653`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002653

Location Chr01:53932899-53935065 (+)

Description Similar to PID2: Protein kinase PINOID 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g26700`	Serine/threonine-protein kinase involved in the regulation of auxin signaling.	NPY genes and AGC kinases define two key steps in auxin-mediated organogenesis in Arabidopsis.2008 · DOI: 10.1073/pnas.0809761106
`At5g47750`	Protein kinase that regulates the auxin transport activity of PIN auxin efflux facilitators by direct phosphorylation.	D6PK AGCVIII kinases are required for auxin transport and phototropic hypocotyl bending in Arabidopsis.2013 · DOI: 10.1105/tpc.113.111484

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0174700`	Serine/threonine-protein kinase involved in the regulation of auxin signaling.	No verified direct reference in this release
`UniProt: A2YBX5`	May play a role in the regulation of metabolism and signal transduction processes.	No verified direct reference in this release
`Os06g0291600`	May play a role in the regulation of metabolism and signal transduction processes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002653 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0009638 phototropism Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0010540 basipetal auxin transport Biological Process

GO:0048367 shoot system development Biological Process

GO:0048608 reproductive structure development Biological Process

GO:0048825 cotyledon development Biological Process

GO:0099402 plant organ development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT2G26700

ath:AT5G47750

dosa:Os01g0174700

dosa:Os06g0291600

osa:4340792

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.581

Rank 1 · LXL04_002653 · OH-1004

Nucleus0.397

Rank 2 · LXL04_002653 · OH-1004

Cell membrane0.158

Rank 3 · LXL04_002653 · OH-1004

Mitochondrion0.037

Rank 4 · LXL04_002653 · OH-1004

Endoplasmic reticulum0.036

Rank 5 · LXL04_002653 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase75-229 aa

PF07714.24PK_Tyr_Ser-Thr76-230 aa

PF00069.32Pkinase312-422 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002653	`PF00069.32`	Pkinase	75	229	1.2e-54	186.2
LXL04_002653	`PF07714.24`	PK_Tyr_Ser-Thr	76	230	2.5e-23	83.5
LXL04_002653	`PF00069.32`	Pkinase	312	422	1.2e-54	186.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q64FQ2`	Arabidopsis thaliana	Protein kinase PINOID 2	59.091%	Swiss-Prot	strong database homology
`Q39183`	Arabidopsis thaliana	Serine/threonine-protein kinase D6PKL2	50.905%	Swiss-Prot	strong database homology
`Q94E49`	Oryza sativa subsp. japonica	Protein kinase PINOID 2	58.532%	Swiss-Prot	strong database homology
`A2YBX5`	Oryza sativa subsp. indica	Protein kinase G11A	54.286%	Swiss-Prot	strong database homology
`Q0DCT8`	Oryza sativa subsp. japonica	Protein kinase G11A	54.286%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card