TkA01G428560 | RubberDandelionOmics

Gene overview

TkA01G428560

Reference: TK1151 Chr: Chr01 Coordinates: 106982147-106986145 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1062 bp · TkA01G428560|TK1151|cDNA

ATTAATTTCCCTCTTCTCTCTCCCTCAGATATATACATATAATATATATATATCTATATATGTTTCTTGATCTATAAATAGAAAGGACTTGAAAGAAGCAACACTGTAGTGATCACCCATCTTCAACACTCTCACACAAAGATTTGAATTTCTCTTCGATTAATTTAGCTCTCTCCCTTGAGCAGTTTCTCTAGAGAGAGAGAGAGAGAGAGAGATGTCAAGCAGCAGCTGCATAGATGTAGCAGCAGCATCCGAACAAC...

CDS

Download CDS FASTA

627 bp · TkA01G428560|TK1151|CDS

ATGTCAAGCAGCAGCTGCATAGATGTAGCAGCAGCATCCGAACAACTTTGTTATATCCCTTGTAACTTTTGCAATATTGTTCTTGCGGTGAGTGTACCATGCAGCAGCTTGTTTGACATTGTGACAGTTAGATGTGGACACTGCACCAATCTGTGGTCTGTGAATATGGGCATGGCTGCTGCCTTTCACCAGTCTCTCTCAAATTCTAATTCCACCTCCCAAGATTGTACTTCTCATCAACATGGCCAGGCTCCCAACCA...

Protein

Download Protein FASTA

208 aa · TkA01G428560|TK1151|PROTEIN

MSSSSCIDVAAASEQLCYIPCNFCNIVLAVSVPCSSLFDIVTVRCGHCTNLWSVNMGMAAAFHQSLSNSNSTSQDCTSHQHGQAPNHTPPNYRVDLGSASKYNRMPTRPSQASITNDQKINRPPEKRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGLMLEANNHQAKLDELSCVQGSEKRLRSRAALFKK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G428560`
TK1151 ID	TkA01G428560
OH-1004 ID	LXL04_002690
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 90.385 / OH-1004 50.811 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G428560

Location Chr01:106982147-106986145 (+)

Description Similar to YAB5: Axial regulator YABBY 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g26580`	Promotes adaxial cell identity.	No verified direct reference in this release
`At1g08465`	Involved in the abaxial cell fate determination during embryogenesis and organogenesis.	No verified direct reference in this release
`At2g45190`	Involved in the abaxial cell fate determination during embryogenesis and organogenesis.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0650000`	Protein YABBY 2.	No verified direct reference in this release
`Os12g0621100`	Protein YABBY 6.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002690 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0003002 regionalization Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009944 polarity specification of adaxial/abaxial axis Biological Process

GO:0010154 fruit development Biological Process

GO:0010158 abaxial cell fate specification Biological Process

GO:0045165 cell fate commitment Biological Process

GO:0050793 regulation of developmental process Biological Process

GO:1902183 regulation of shoot apical meristem development Biological Process

GO:2000024 regulation of leaf development Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G08465

ath:AT2G26580

dosa:Os03g0650000

dosa:Os04g0536300

dosa:Os12g0621100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.742

Rank 1 · TkA01G428560 · TK1151

Cytoplasm0.296

Rank 2 · TkA01G428560 · TK1151

Cell membrane0.069

Rank 3 · TkA01G428560 · TK1151

Endoplasmic reticulum0.051

Rank 4 · TkA01G428560 · TK1151

Lysosome / Vacuole0.024

Rank 5 · TkA01G428560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24868YABBY_N12-61 aa

PF04690YABBY89-104 aa

PF04690YABBY114-174 aa

PF06244Ccdc124116-169 aa

PF09011HMG_box_2124-167 aa

PF00505HMG_box129-167 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G428560	`PF24868`	YABBY_N	12	61	2.4e-28	98.2
TkA01G428560	`PF04690`	YABBY	89	104	2.8e-37	127.6
TkA01G428560	`PF04690`	YABBY	114	174	2.8e-37	127.6
TkA01G428560	`PF06244`	Ccdc124	116	169	6.5e-05	23.9
TkA01G428560	`PF09011`	HMG_box_2	124	167	0.00011	23.5
TkA01G428560	`PF00505`	HMG_box	129	167	0.002	19.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GW46`	Arabidopsis thaliana	sp\|Q8GW46\|YAB5_ARATH Axial regulator YABBY 5	69.900%	Swiss-Prot	High
`Q9XFB0`	Arabidopsis thaliana	sp\|Q9XFB0\|YAB2_ARATH Putative axial regulator YABBY 2	52.400%	Swiss-Prot	High
`O22152`	Arabidopsis thaliana	sp\|O22152\|YAB1_ARATH Axial regulator YABBY 1	52.700%	Swiss-Prot	High
`Q10FZ7`	Oryza sativa subsp. japonica	sp\|Q10FZ7\|YAB2_ORYSJ Protein YABBY 2	53.000%	Swiss-Prot	High
`Q2QM17`	Oryza sativa subsp. japonica	sp\|Q2QM17\|YAB6_ORYSJ Protein YABBY 6	53.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card