TkA01G425990 | RubberDandelionOmics

Gene overview

TkA01G425990

Reference: TK1151 Chr: Chr01 Coordinates: 106328612-106346136 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

964 bp · TkA01G425990|TK1151|cDNA

AAAAAAGTTAAAATAGAAAAGTTTAGTTTCTATGACATATGCCACTTGCTGGAGCATCTTTATTTTTGAATCCATCTAATCAACATCTCCACTTCCTCTCCTGGCGGCAATGCTCGAAACAGAAGTTCAGGATATATCTAATGACGCCGATTACGCCGCCGCATCTCAAGAAACATGGAAGCCTTATAAAGGCCGAAGTTCGAAGGATACGCTCTCTAAGAGAGACAAGAATATATACACTATAGGAAAGGTGCGTTTTT...

CDS

Download CDS FASTA

1485 bp · TkA01G425990|TK1151|CDS

ATGCTCGAAACAGAAGTTCAGGATATATCTAATGACGCCGATTACGCCGCCGCATCTCAAGAAGGCTCGTTAAGTAGCAAGCACAGCTCTTGTAGCCAGCTAGAAAATGCAGAAATAGTGTATTTGAAGGATAATGTCACAATTAACCCAACTCAATATGCAGCCGGCAGGATCAGTGGACAGTTAAAGCTTATTAAGCAAGATTCCTTGCTATTTATGACATGGAAGCCTTATAAAGGCCGAAGTTCGAAGGATACGCT...

Protein

Download Protein FASTA

494 aa · TkA01G425990|TK1151|PROTEIN

MLETEVQDISNDADYAAASQEGSLSSKHSSCSQLENAEIVYLKDNVTINPTQYAAGRISGQLKLIKQDSLLFMTWKPYKGRSSKDTLSKRDKNIYTIGKVRFSDIQSIRGHSPKIGWQYVVISLSSGLTYPPLYFHNGGVGEFLATIKQHVYIVRSSNNANVFLVNNFKDPLEFDKLSLVWGKPRQPPLRLEEWETFLDVEGRVLSPNDLKRRIFYGGVDHSLRKEIWKFLLGYYAYDSTYLERQHFSTIKKSEYETIRN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G425990`
TK1151 ID	TkA01G425990
OH-1004 ID	LXL04_002713
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.500
Protein coverage (%)	TK1151 81.781 / OH-1004 24.862 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G425990`
Location	Chr01:106328612-106346136 (+)
Description	Similar to Tbc1d15: TBC1 domain family member 15
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_002713` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006914 autophagy Biological Process GO:0015031 protein transport Biological Process GO:0042147 retrograde transport, endosome to Golgi Biological Process GO:0043087 regulation of GTPase activity Biological Process GO:0005576 extracellular region Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005776 autophagosome Cellular Component GO:0005829 cytosol Cellular Component GO:0055037 recycling endosome Cellular Component GO:0005096 GTPase activator activity Molecular Function
KEGG gene cross-reference	hsa:64786 hsa:79735 mmu:233204 mmu:66687 yli:2907695 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.710

Rank 1 · TkA01G425990 · TK1151

Nucleus0.248

Rank 2 · TkA01G425990 · TK1151

Golgi apparatus0.115

Rank 3 · TkA01G425990 · TK1151

Cell membrane0.105

Rank 4 · TkA01G425990 · TK1151

Lysosome / Vacuole0.103

Rank 5 · TkA01G425990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12068PH_RBD39-176 aa

PF20441TerL_nuclease66-98 aa

PF03556Cullin_binding189-232 aa

PF20441TerL_nuclease200-272 aa

PF00566RabGAP-TBC222-450 aa

PF03556Cullin_binding225-238 aa

PF23436RabGap-TBC_2308-465 aa

PF03556Cullin_binding393-437 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G425990	`PF12068`	PH_RBD	39	176	1.5e-14	54.5
TkA01G425990	`PF20441`	TerL_nuclease	66	98	0.08	12.8
TkA01G425990	`PF03556`	Cullin_binding	189	232	0.6	11.2
TkA01G425990	`PF20441`	TerL_nuclease	200	272	0.08	12.8
TkA01G425990	`PF00566`	RabGAP-TBC	222	450	4.1e-51	174.4
TkA01G425990	`PF03556`	Cullin_binding	225	238	0.6	11.2
TkA01G425990	`PF23436`	RabGap-TBC_2	308	465	4.2e-15	56.7
TkA01G425990	`PF03556`	Cullin_binding	393	437	0.6	11.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card