TkA01G412910 | RubberDandelionOmics

Gene overview

TkA01G412910

Reference: TK1151 Chr: Chr01 Coordinates: 103023855-103025642 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

952 bp · TkA01G412910|TK1151|cDNA

ATATATATATATAAGGTGGATCAGGTGAGAAAGAATTTTTTGGTGAGAAGGTAAGAAGAAATCCTGACCACTCATCTAGAAGGGCAAATCAGTCCAATTAAATTTTGAGAATGCGTAAATTGCGGGTGTCTACTGGAAGGTTACCAGCCTACCGGATCCAATGCCATCCCCAAACATTCAAAAAACACACTCTGTCCCTTCTTCTTCATTGCGATCGAACAGACGAACACCCACAGCAAACTCCTCCTTCTATGTCCGAT...

CDS

Download CDS FASTA

408 bp · TkA01G412910|TK1151|CDS

ATGTGCCGGAGTTGGAATCGGAGGCCGGAGGTGGGATCGGCGTTCTCCTCCTTCTCTGATTTGCCATCTGAAACCATTCCCCTCTCCTCCTCCTTCCCTGTTCGTGTCAAAATCGACCGCTCAGAGAAATCCAGCACCGTCGAGCAAAGGCGAGATCTGTGGGTTCCGACGGACAAGATCCACCACCGTGTTCTCTCCTCCAAATCGCCGAAGCAGGAAGCCACGAAACTAGGTGGTGCTACTGCTGAAATAATGTCTGA...

Protein

Download Protein FASTA

135 aa · TkA01G412910|TK1151|PROTEIN

MCRSWNRRPEVGSAFSSFSDLPSETIPLSSSFPVRVKIDRSEKSSTVEQRRDLWVPTDKIHHRVLSSKSPKQEATKLGGATAEIMSDLLAFEADRRAVNITINSIGTELTREDRRKLYSSFGLLYPYGHEELAVC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G412910`
TK1151 ID	TkA01G412910
OH-1004 ID	LXL04_021021
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 62.212 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G412910

Location Chr01:103023855-103025642 (-)

Description Similar to VHA-d1: V-type proton ATPase subunit d1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g28710`	Subunit of the integral membrane V0 complex of vacuolar ATPase.	No verified direct reference in this release
`At3g28715`	Subunit of the integral membrane V0 complex of vacuolar ATPase.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0587000`	Subunit of the integral membrane V0 complex of vacuolar ATPase.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021021 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007034 vacuolar transport Biological Process

GO:0007035 vacuolar acidification Biological Process

GO:0016241 regulation of macroautophagy Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005765 lysosomal membrane Cellular Component

GO:0005769 early endosome Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT3G28710

ath:AT3G28715

ddi:DDB_G0273071

ddi:DDB_G0273657

dosa:Os01g0587000

hsa:245972

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.324

Rank 1 · TkA01G412910 · TK1151

Cytoplasm0.299

Rank 2 · TkA01G412910 · TK1151

Mitochondrion0.214

Rank 3 · TkA01G412910 · TK1151

Plastid0.121

Rank 4 · TkA01G412910 · TK1151

Cell membrane0.077

Rank 5 · TkA01G412910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01992vATP-synt_AC3974-133 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G412910	`PF01992`	vATP-synt_AC39	74	133	1.7e-12	48.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LJI5`	Arabidopsis thaliana	sp\|Q9LJI5\|VA0D1_ARATH V-type proton ATPase subunit d1	95.000%	Swiss-Prot	Low
`Q9LHA4`	Arabidopsis thaliana	sp\|Q9LHA4\|VA0D2_ARATH V-type proton ATPase subunit d2	95.000%	Swiss-Prot	Low
`Q8RU33`	Oryza sativa subsp. japonica	sp\|Q8RU33\|VA0D_ORYSJ Probable V-type proton ATPase subunit d	93.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card