Gene Card
Gene overview
cDNA / CDS / Protein Sequences
625 bp · TkA01G411940|TK1151|cDNA
GACAAAGAATTTCATGGTTTCGTGTAATGCGAGAACAAAGCAAGCCAGTCAAGCGAAATATATATCTATTTTGAATATTATTCAGGGAGAAGTGGATCCAACTAAAGTGCATGAAAGTTTGCAGAGGATACGTGAAAGAAAACTTGTTAACTTTATAGAATGGGGTCCAGCTAGCATTCAGGTTGCACTTTCAAGGAAGTCGCCATATGTTCGAACTGCCCACAGGGTGAGTGGGCTGATGTTAGCAAGTTACACTGGAA...
519 bp · TkA01G411940|TK1151|CDS
ATGGTTTCGTGTAATGCGAGAACAAAGCAAGCCAGTCAAGCGAAATATATATCTATTTTGAATATTATTCAGGGAGAAGTGGATCCAACTAAAGTGCATGAAAGTTTGCAGAGGATACGTGAAAGAAAACTTGTTAACTTTATAGAATGGGGTCCAGCTAGCATTCAGGTTGCACTTTCAAGGAAGTCGCCATATGTTCGAACTGCCCACAGGGTGAGTGGGCTGATGTTAGCAAGTTACACTGGAATTCGACATTTATT...
Protein
Download Protein FASTA172 aa · TkA01G411940|TK1151|PROTEIN
MVSCNARTKQASQAKYISILNIIQGEVDPTKVHESLQRIRERKLVNFIEWGPASIQVALSRKSPYVRTAHRVSGLMLASYTGIRHLFSKCLSQYSLLRKRQAFLDKYKSFPMFADNDLSEFDESKDILDSLVDEYKACESPDYIKWGMEDPHNLLTDEGTDIGTVDPTYQYQ
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G411940 |
|---|---|
| TK1151 ID | TkA01G411940 |
| OH-1004 ID | LXL04_007542 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 98.800 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 32.762Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G411940 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:102744956-102751211 (-) | |||||||||
| Description | Similar to TUBG1: Tubulin gamma-1 chain | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000070 mitotic sister chromatid segregation Biological Process GO:0000212 meiotic spindle organization Biological Process GO:0000278 mitotic cell cycle Biological Process GO:0000911 cytokinesis by cell plate formation Biological Process GO:0007020 microtubule nucleation Biological Process GO:0007052 mitotic spindle organization Biological Process GO:0009624 response to nematode Biological Process GO:0010103 stomatal complex morphogenesis Biological Process GO:0031122 cytoplasmic microtubule organization Biological Process GO:0046785 microtubule polymerization Biological Process GO:0048366 leaf development Biological Process GO:0048768 root hair cell tip growth Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT3G61650 ath:AT5G05620 dosa:Os05g0156600 zma:542436 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF03953Tubulin_C1-90 aaPF21975ASNSD1-SEP97-144 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G411940 | PF03953 | Tubulin_C | 1 | 90 | 3.1e-26 | 92.7 |
| TkA01G411940 | PF21975 | ASNSD1-SEP | 97 | 144 | 0.17 | 12.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.