TkA01G409160 | RubberDandelionOmics

Gene overview

TkA01G409160

Reference: TK1151 Chr: Chr01 Coordinates: 102111912-102113017 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

655 bp · TkA01G409160|TK1151|cDNA

ATCTATGTAATTCGAATTTATAATTGCGTTTAATCTGATGTATACAGTTTTCATATGTTCTTATTCCTTATATGCGTTTAATCTGATGTAAACAGTTTTCAGTGAGATTTCATTTGTGTAACATATAGATTGTTGATTGTTCTATTTCTATACTGTTGCTAATGAGGCCTAAACATCGGGAATATTGTCTTTCATTTGAGTTAACCGAAAGTGAATGTTCTATGGTTGCAAAAATGTTAGGGTTGAAAATAGCAACGTCA...

CDS

Download CDS FASTA

444 bp · TkA01G409160|TK1151|CDS

ATGTTCTATGGTTGCAAAAATGTTAGGGTTGAAAATAGCAACGTCAATGGTGTTGCTGAATCAGCTGCTGATGAGGCACAGCTGGCGGAAAGTGAGCAAGCCACGTATACGTCCTCAAACAACGATCTAAAAGGCACGAAAGCTTACCAAGAAGCCGATGTTCCTGGATTGTATAATCTTGCTATGGCCATTGTTGACTACAGAGGGCATAGAGTAGTAGCACAGAGTGTTCTTCCTGGAATCTTACAAGGTGATAAATC...

Protein

Download Protein FASTA

147 aa · TkA01G409160|TK1151|PROTEIN

MFYGCKNVRVENSNVNGVAESAADEAQLAESEQATYTSSNNDLKGTKAYQEADVPGLYNLAMAIVDYRGHRVVAQSVLPGILQGDKSNSLLYGSVDNGKKICWNQDFHAKVLEASKRLRVKEHTVVDGSGNVFQIAAAVECKGIVRK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G409160`
TK1151 ID	TkA01G409160
OH-1004 ID	LXL04_034226
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.000
Protein coverage (%)	TK1151 90.476 / OH-1004 9.589 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G409160

Location Chr01:102111912-102113017 (+)

Description Similar to FMT: Clustered mitochondria protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g52140`	mRNA-binding protein involved in proper cytoplasmic distribution of mitochondria (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034226 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000266 mitochondrial fission Biological Process

GO:0000281 mitotic cytokinesis Biological Process

GO:0007005 mitochondrion organization Biological Process

GO:0008053 mitochondrial fusion Biological Process

GO:0010636 positive regulation of mitochondrial fusion Biological Process

GO:0019750 chloroplast localization Biological Process

GO:0048312 intracellular distribution of mitochondria Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT3G52140

cqu:CpipJ_CPIJ001445

ddi:DDB_G0292806

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.589

Rank 1 · TkA01G409160 · TK1151

Nucleus0.276

Rank 2 · TkA01G409160 · TK1151

Mitochondrion0.114

Rank 3 · TkA01G409160 · TK1151

Cell membrane0.113

Rank 4 · TkA01G409160 · TK1151

Endoplasmic reticulum0.105

Rank 5 · TkA01G409160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13236CLU24-145 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G409160	`PF13236`	CLU	24	145	2.6e-34	119.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4J5S1`	Arabidopsis thaliana	sp\|F4J5S1\|CLU_ARATH Clustered mitochondria protein	81.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card