LXL04_034226 | RubberDandelionOmics

Gene overview

LXL04_034226

Reference: OH-1004 Chr: Chr07 Coordinates: 92282043-92288516 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4164 bp · LXL04_034226|LXL04_034226|OH1004|cDNA

ATGGCTGGGAAATCAAGCAGAGGACGGAATAAGAAAGCGGCACAAAACGCCACAAGTTCTACTGAACAGGCGGCTTCCTCTAATGGTCATTCTAAAGATAACTCGACTCCTGTTGAAGAAACAAAGGTGGACTCCAATGGAGTCCTAGCTTCGGCTGAGGTACAAGCCACGAAGCCAGAGGTTAAGGAGCCAGAAAATGCAAATGTAGAGAACCAGGCTAAGCAAGCAGGTGACATTCATCTTTTCCCGGTTCCTGTGAA...

CDS

Download CDS FASTA

4164 bp · LXL04_034226|LXL04_034226|OH1004|CDS

ATGGCTGGGAAATCAAGCAGAGGACGGAATAAGAAAGCGGCACAAAACGCCACAAGTTCTACTGAACAGGCGGCTTCCTCTAATGGTCATTCTAAAGATAACTCGACTCCTGTTGAAGAAACAAAGGTGGACTCCAATGGAGTCCTAGCTTCGGCTGAGGTACAAGCCACGAAGCCAGAGGTTAAGGAGCCAGAAAATGCAAATGTAGAGAACCAGGCTAAGCAAGCAGGTGACATTCATCTTTTCCCGGTTCCTGTGAA...

Protein

Download Protein FASTA

1387 aa · LXL04_034226|LXL04_034226|OH1004|PROTEIN

MAGKSSRGRNKKAAQNATSSTEQAASSNGHSKDNSTPVEETKVDSNGVLASAEVQATKPEVKEPENANVENQAKQAGDIHLFPVPVKTQFGEKLELQLSPSDSVMDVRQFLLDAPETCFFTCYDLLLHTKDGSTHHLEDYHEISEVADITTGDCSLEMIAALYDDRSIRAHVHRTRELLSLSTLHSSLSTSLALQHEMAGQTANSGDPAKSEVLELENLGFMEDVSGSLSNLLSSPSKEIKCVESIVFSSFNPPPSYRRL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_034226`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_034226

Location Chr07:92282043-92288516 (+)

Description Similar to FMT: Clustered mitochondria protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g52140`	mRNA-binding protein involved in proper cytoplasmic distribution of mitochondria (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034226 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000266 mitochondrial fission Biological Process

GO:0000281 mitotic cytokinesis Biological Process

GO:0007005 mitochondrion organization Biological Process

GO:0008053 mitochondrial fusion Biological Process

GO:0010636 positive regulation of mitochondrial fusion Biological Process

GO:0019750 chloroplast localization Biological Process

GO:0048312 intracellular distribution of mitochondria Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT3G52140

cqu:CpipJ_CPIJ001445

ddi:DDB_G0292806

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.640

Rank 1 · LXL04_034226 · OH-1004

Nucleus0.263

Rank 2 · LXL04_034226 · OH-1004

Golgi apparatus0.092

Rank 3 · LXL04_034226 · OH-1004

Mitochondrion0.085

Rank 4 · LXL04_034226 · OH-1004

Cell membrane0.083

Rank 5 · LXL04_034226 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15044.12CLU_N100-178 aa

PF13236.12CLU384-646 aa

PF12807.13eIF3_p135779-967 aa

PF24885.2TPR_NPHP3987-1107 aa

PF13424.13TPR_121044-1107 aa

PF13424.13TPR_121078-1150 aa

PF24885.2TPR_NPHP31089-1184 aa

PF13424.13TPR_121120-1182 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_034226	`PF15044.12`	CLU_N	100	178	9e-15	55.6
LXL04_034226	`PF13236.12`	CLU	384	646	1e-73	248.6
LXL04_034226	`PF12807.13`	eIF3_p135	779	967	1.3e-48	166.1
LXL04_034226	`PF24885.2`	TPR_NPHP3	987	1107	1.1e-14	55.2
LXL04_034226	`PF13424.13`	TPR_12	1044	1107	5.2e-30	104.2
LXL04_034226	`PF13424.13`	TPR_12	1078	1150	5.2e-30	104.2
LXL04_034226	`PF24885.2`	TPR_NPHP3	1089	1184	1.1e-14	55.2
LXL04_034226	`PF13424.13`	TPR_12	1120	1182	5.2e-30	104.2
LXL04_034226	`PF13374.13`	TPR_10	1121	1161	6.2e-17	61.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4J5S1`	Arabidopsis thaliana	Clustered mitochondria protein	66.992%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card