TkA01G389280 | RubberDandelionOmics

Gene overview

TkA01G389280

Reference: TK1151 Chr: Chr01 Coordinates: 97153371-97160653 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4203 bp · TkA01G389280|TK1151|cDNA

GAACCAAAACCCTTGCTTATCACGCACACCTCTTTACTAAGCTACCCACTGCTACGACACCGGCCCACCACCGGCGCCGTAACTCATCACCCCCACCACCACTACCACTGCGCTGTAACTCACCACTACCACCGGCGCTATTTCCTACCACCATCAGCGTTGTTACCCACAACCACCACCACCACCACAACCGGCGCTGCTACTTGATCGACCACATTGGCAACTGTTTCCATAGCAATGGACGATGTATCCGAAGGCAA...

CDS

Download CDS FASTA

3546 bp · TkA01G389280|TK1151|CDS

ATGGACGATGTATCCGAAGGCAAAGATTTCTCATTCCCAAAACAGGAAGAGAAGATCTTAGAATGGTGGACCGAAGTCAAAGCATTTGAAACCCAACTTGAAAAAACCAAAGACCTACCAGAATACATCTTCTACGATGGCCCTCCATTTGCCACTGGTCTCCCTCACTACGGCCACATCCTAGCTGGCACAATCAAGGACATCGTCACCCGCTACCAGACGATGACGGGGCACCACGTCACCCGGCGGTTCGGTTGGGA...

Protein

Download Protein FASTA

1181 aa · TkA01G389280|TK1151|PROTEIN

MDDVSEGKDFSFPKQEEKILEWWTEVKAFETQLEKTKDLPEYIFYDGPPFATGLPHYGHILAGTIKDIVTRYQTMTGHHVTRRFGWDCHGLPVEHEIDIKLGIKSREDVIKMGIGNYNEECRSIVTRYVGEWEKVITRTGRWIDFKNDYKTMDLNFMESVWWVFSQLFKKNLVYRGFKVMPYSTGCKTPLSNFEANSNYKEVPDPEIMVTFPIVDDKDGAAFVAWTTTPWTLPSNLALCVNSNLVYVKVKSKSNGKIYVV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G389280`
TK1151 ID	TkA01G389280
OH-1004 ID	LXL04_038709
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	88.100
Protein coverage (%)	TK1151 99.915 / OH-1004 80.205 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G389280

Location Chr01:97153371-97160653 (+)

Description Similar to At4g10320: Isoleucine--tRNA ligase, cytoplasmic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g10320`	Isoleucine--tRNA ligase, cytoplasmic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038709 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006418 tRNA aminoacylation for protein translation Biological Process

GO:0006428 isoleucyl-tRNA aminoacylation Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0048608 reproductive structure development Biological Process

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0016020 membrane Cellular Component

GO:0017101 aminoacyl-tRNA synthetase multienzyme complex Cellular Component

GO:0070062 extracellular exosome Cellular Component

GO:0000049 tRNA binding Molecular Function

GO:0002161 aminoacyl-tRNA deacylase activity Molecular Function

KEGG gene cross-reference

ath:AT4G10320

hsa:3376

mmu:105148

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.792

Rank 1 · TkA01G389280 · TK1151

Nucleus0.233

Rank 2 · TkA01G389280 · TK1151

Mitochondrion0.094

Rank 3 · TkA01G389280 · TK1151

Cell membrane0.060

Rank 4 · TkA01G389280 · TK1151

Peroxisome0.060

Rank 5 · TkA01G389280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00133tRNA-synt_118-666 aa

PF09334tRNA-synt_1g49-105 aa

PF01406tRNA-synt_1e54-80 aa

PF09334tRNA-synt_1g378-496 aa

PF19302DUF5915506-525 aa

PF01406tRNA-synt_1e604-659 aa

PF09334tRNA-synt_1g615-660 aa

PF00133tRNA-synt_1714-736 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G389280	`PF00133`	tRNA-synt_1	18	666	8.1e-158	526.2
TkA01G389280	`PF09334`	tRNA-synt_1g	49	105	7e-15	55.4
TkA01G389280	`PF01406`	tRNA-synt_1e	54	80	0.0059	16.7
TkA01G389280	`PF09334`	tRNA-synt_1g	378	496	7e-15	55.4
TkA01G389280	`PF19302`	DUF5915	506	525	3e-07	31.3
TkA01G389280	`PF01406`	tRNA-synt_1e	604	659	0.0059	16.7
TkA01G389280	`PF09334`	tRNA-synt_1g	615	660	7e-15	55.4
TkA01G389280	`PF00133`	tRNA-synt_1	714	736	8.1e-158	526.2
TkA01G389280	`PF08264`	Anticodon_1	724	874	3.4e-29	102.4
TkA01G389280	`PF19302`	DUF5915	1006	1061	3e-07	31.3
TkA01G389280	`PF08264`	Anticodon_1	1011	1036	3.4e-29	102.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JLM5`	Arabidopsis thaliana	sp\|F4JLM5\|SYIC_ARATH Isoleucine--tRNA ligase, cytoplasmic	76.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card