TkA01G381010 | RubberDandelionOmics

Gene overview

TkA01G381010

Reference: TK1151 Chr: Chr01 Coordinates: 95158764-95170847 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1701 bp · TkA01G381010|TK1151|cDNA

GGCTGATTTGAAGAAATTTTTAAAAACATCACCAAGAAAGGGCATGAAAAAATCGAAGCTGCCAAACGCATCAAAACACGAAGATGGGGTTGATTTGATCAGTAGCATGCCAGATGGTGTTCTTCTTTTGATTCTTTCACGTCGTTTATGCACCGAAGAAGTAGTTCGAAGCAGCATTTTGTCCAGACGATGGAGGTATTTGTGGACTGCAATTCCCTCTGTGAAGATAGACGTACGTTACAGAGGAAAATTCAACCGCA...

CDS

Download CDS FASTA

1278 bp · TkA01G381010|TK1151|CDS

ATGAAAAAATCGAAGCTGCCAAACGCATCAAAACACGAAGATGGGGTTGATTTGATCAGTAGCATGCCAGATGGTGTTCTTCTTTTGATTCTTTCACGTCGTTTATGCACCGAAGAAGTAGTTCGAAGCAGCATTTTGTCCAGACGATGGAGGTATTTGTGGACTGCAATTCCCTCTGTGAAGATAGACGTACGTTACAGAGGAAAATTCAACCGCAACGGATTCAAAAAAAGCGAATTCACAGAGTTTGTGTATTGGGT...

Protein

Download Protein FASTA

425 aa · TkA01G381010|TK1151|PROTEIN

MKKSKLPNASKHEDGVDLISSMPDGVLLLILSRRLCTEEVVRSSILSRRWRYLWTAIPSVKIDVRYRGKFNRNGFKKSEFTEFVYWVLSNRSADLDYFRLFCLDYYSMSTVGRWIHIAVTRNVKQLDLGFSPKENTEAVEMPHCLVNCGSLEVLKLYLPGSRLRLPNFTGFPALRVLDLYDAYLQEDRELINGFLQSLPLLEELRLADCFIEELDLLCISCPKLKTLTLRNIDDLLMCGGIKISCPKLVNLDITGHVANN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G381010`
TK1151 ID	TkA01G381010
OH-1004 ID	LXL04_003255
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	85.700
Protein coverage (%)	TK1151 95.059 / OH-1004 97.356 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G381010

Location Chr01:95158764-95170847 (+)

Description Similar to At5g56420: F-box/FBD/LRR-repeat protein At5g56420

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g56420`	F-box/FBD/LRR-repeat protein At5g56420.	No verified direct reference in this release
`At1g69630`	F-box/LRR-repeat protein 13.	No verified direct reference in this release
`At2g26860`	FBD-associated F-box protein At2g26860.	No verified direct reference in this release
`At1g78750`	F-box/FBD/LRR-repeat protein At1g78750.	No verified direct reference in this release
`At2g04230`	F-box/FBD/LRR-repeat protein At2g04230.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003255 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G16930

ath:AT1G69630

ath:AT3G52680

ath:AT5G56420

ath:AT5G56560

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.810

Rank 1 · TkA01G381010 · TK1151

Cytoplasm0.242

Rank 2 · TkA01G381010 · TK1151

Cell membrane0.044

Rank 3 · TkA01G381010 · TK1151

Endoplasmic reticulum0.041

Rank 4 · TkA01G381010 · TK1151

Plastid0.018

Rank 5 · TkA01G381010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box19-55 aa

PF12937F-box-like19-53 aa

PF23622LRR_At1g61320_AtMIF193-374 aa

PF23598LRR_1497-129 aa

PF24758LRR_At5g56370112-187 aa

PF12799LRR_4122-129 aa

PF23320Zn_SUZ12134-159 aa

PF12799LRR_4155-181 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G381010	`PF00646`	F-box	19	55	0.0027	18.3
TkA01G381010	`PF12937`	F-box-like	19	53	0.0056	17.1
TkA01G381010	`PF23622`	LRR_At1g61320_AtMIF1	93	374	1.4e-12	48.4
TkA01G381010	`PF23598`	LRR_14	97	129	0.12	11.8
TkA01G381010	`PF24758`	LRR_At5g56370	112	187	9.5e-13	49.0
TkA01G381010	`PF12799`	LRR_4	122	129	5.3e-08	33.6
TkA01G381010	`PF23320`	Zn_SUZ12	134	159	0.049	14.1
TkA01G381010	`PF12799`	LRR_4	155	181	5.3e-08	33.6
TkA01G381010	`PF23598`	LRR_14	165	319	0.12	11.8
TkA01G381010	`PF13855`	LRR_8	167	208	0.6	10.6
TkA01G381010	`PF13855`	LRR_8	168	179	0.6	10.6
TkA01G381010	`PF14580`	LRR_9	189	229	0.19	12.0
TkA01G381010	`PF24758`	LRR_At5g56370	197	349	9.5e-13	49.0
TkA01G381010	`PF13855`	LRR_8	200	231	0.6	10.6
TkA01G381010	`PF12799`	LRR_4	201	235	5.3e-08	33.6
TkA01G381010	`PF14580`	LRR_9	205	271	0.19	12.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FM89`	Arabidopsis thaliana	sp\|Q9FM89\|FDL38_ARATH F-box/FBD/LRR-repeat protein At5g56420	28.300%	Swiss-Prot	Low
`Q9FWZ1`	Arabidopsis thaliana	sp\|Q9FWZ1\|FBL13_ARATH F-box/LRR-repeat protein 13	27.000%	Swiss-Prot	Low
`Q84X02`	Arabidopsis thaliana	sp\|Q84X02\|FBD7_ARATH FBD-associated F-box protein At2g26860	25.200%	Swiss-Prot	Low
`Q9ZV93`	Arabidopsis thaliana	sp\|Q9ZV93\|FDL10_ARATH F-box/FBD/LRR-repeat protein At1g78750	30.600%	Swiss-Prot	Medium
`Q6NKX3`	Arabidopsis thaliana	sp\|Q6NKX3\|FDL14_ARATH F-box/FBD/LRR-repeat protein At2g04230	32.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card