LXL04_003255 | RubberDandelionOmics

Gene overview

LXL04_003255

Reference: OH-1004 Chr: Chr01 Coordinates: 72262806-72264477 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1265 bp · LXL04_003255|LXL04_003255|OH1004|cDNA

ATGAAGAAATCAAATCTGCCAAACGCATCAAAACACGAAGATGGGGTTGATTTGATCAGTAGCATGCCAGATGGTGTTCTTCTTTTGATTCTTTCACGTTGTTTATGCACCGAAGAAGTAGTTCGAAGCAGCGTTTTGTCCAGACGATGGAGGTATTTGTGGACTGCAGTTCCCTCTGTGAACATAAACATACATGACAGAGGAAAATTCAACAACTGCAACGGATTCAAAGAAAGCGAATTCAAAGAGTTTGTGTCTTG...

CDS

Download CDS FASTA

1251 bp · LXL04_003255|LXL04_003255|OH1004|CDS

ATGAAGAAATCAAATCTGCCAAACGCATCAAAACACGAAGATGGGGTTGATTTGATCAGTAGCATGCCAGATGGTGTTCTTCTTTTGATTCTTTCACGTTGTTTATGCACCGAAGAAGTAGTTCGAAGCAGCGTTTTGTCCAGACGATGGAGGTATTTGTGGACTGCAGTTCCCTCTGTGAACATAAACATACATGACAGAGGAAAATTCAACAACTGCAACGGATTCAAAGAAAGCGAATTCAAAGAGTTTGTGTCTTG...

Protein

Download Protein FASTA

416 aa · LXL04_003255|LXL04_003255|OH1004|PROTEIN

MKKSNLPNASKHEDGVDLISSMPDGVLLLILSRCLCTEEVVRSSVLSRRWRYLWTAVPSVNINIHDRGKFNNCNGFKESEFKEFVSWVLSNRSADLDFFRLYCLHYYSMSTVGRWIHFAVTRNVKKLDLWFCPKGNTEAAEMPYCLVNCGSLEVLKLYLPRGRLRLPNFTGFPALRVLDLDDANFEEDRELINGFLQSLLLLEELRLADCFMGELDLLCISCPKLKTLTLEKISYLRMCDGIKISCPKLVDLDIRGYIAD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003255`
TK1151 ID	TkA01G381010
OH-1004 ID	LXL04_003255
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	85.700
Protein coverage (%)	TK1151 95.059 / OH-1004 97.356 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003255

Location Chr01:72262806-72264477 (-)

Description Similar to At5g56420: F-box/FBD/LRR-repeat protein At5g56420

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g56420`	F-box/FBD/LRR-repeat protein At5g56420.	No verified direct reference in this release
`At5g56560`	Putative FBD-associated F-box protein At5g56560.	No verified direct reference in this release
`At1g69630`	F-box/LRR-repeat protein 13.	No verified direct reference in this release
`At1g16930`	F-box/FBD/LRR-repeat protein At1g16930.	No verified direct reference in this release
`At3g52680`	F-box/FBD/LRR-repeat protein At3g52680.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003255 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G16930

ath:AT1G69630

ath:AT3G52680

ath:AT5G56420

ath:AT5G56560

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.794

Rank 1 · LXL04_003255 · OH-1004

Cytoplasm0.248

Rank 2 · LXL04_003255 · OH-1004

Cell membrane0.050

Rank 3 · LXL04_003255 · OH-1004

Endoplasmic reticulum0.046

Rank 4 · LXL04_003255 · OH-1004

Plastid0.019

Rank 5 · LXL04_003255 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23622.2LRR_At1g61320_AtMIF194-375 aa

PF24758.2LRR_At5g56370113-209 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003255	`PF23622.2`	LRR_At1g61320_AtMIF1	94	375	1.4e-11	45.2
LXL04_003255	`PF24758.2`	LRR_At5g56370	113	209	2.1e-10	41.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FM89`	Arabidopsis thaliana	F-box/FBD/LRR-repeat protein At5g56420	30.034%	Swiss-Prot	moderate database homology
`Q9FJV2`	Arabidopsis thaliana	Putative FBD-associated F-box protein At5g56560	29.558%	Swiss-Prot	weak database homology
`Q9FWZ1`	Arabidopsis thaliana	F-box/LRR-repeat protein 13	30.000%	Swiss-Prot	moderate database homology
`Q9FZ52`	Arabidopsis thaliana	F-box/FBD/LRR-repeat protein At1g16930	27.863%	Swiss-Prot	weak database homology
`Q9LXJ6`	Arabidopsis thaliana	F-box/FBD/LRR-repeat protein At3g52680	33.184%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card