TkA01G373590 | RubberDandelionOmics

Gene overview

TkA01G373590

Reference: TK1151 Chr: Chr01 Coordinates: 93212415-93215236 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1028 bp · TkA01G373590|TK1151|cDNA

GGCTACTCGTTTTCAAAATGAAAATCCAAAGAAACAAACAACCCTTTGTATAGGAGATAACTTGGGATAAAAGAAATAATTTTTCTTCTCGGATATAAAAGGAAAATTATAAATGGCAGACAGCGGCAAGAGAAGGCGAAGACCCTCAAGTATTAACCCATAAGATTGATCTCTCCACGACTTGTATTGTAGAGCAGCTAGTTTGAGGTTTTCTTCTAGGATCATCACGTTATACACTCATACTTGCAAACAAATCCATG...

CDS

Download CDS FASTA

504 bp · TkA01G373590|TK1151|CDS

ATGGATGCGAAGATCGGGAAATTCTTCGAGTCGGTGGGCACCTTCTTCACCGGCGGTGATTCTATTCCCTGGTGCGACTCCGACATTGTTGTTGGTTGTGAGCGTGAGGTTGCTGAATCTGAGAAAGGCTCTTCTGATGAACTAAAAAGCGAGTGCCTTTTGCGCCTTTCATGGGCTCTTGTTCACTCAAAACGACCCGAAGATGTACAACGTGGGATCGCTATGCTTGAAGGTTTATTGCCTGGCACTACTAACCCCCT...

Protein

Download Protein FASTA

167 aa · TkA01G373590|TK1151|PROTEIN

MDAKIGKFFESVGTFFTGGDSIPWCDSDIVVGCEREVAESEKGSSDELKSECLLRLSWALVHSKRPEDVQRGIAMLEGLLPGTTNPLQMREKMYLLAVGYYRSGDYPRSRHLVDRCLEIAPDWRQAISLKKAIEDRITKDGVIGIGIAATAVGLVAGGIAAALSRKK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G373590`
TK1151 ID	TkA01G373590
OH-1004 ID	LXL04_021074
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	77.600
Protein coverage (%)	TK1151 96.407 / OH-1004 24.431 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G373590

Location Chr01:93212415-93215236 (+)

Description Similar to PCMP-H28: Pentatricopeptide repeat-containing protein At4g21065

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g57090`	Component of the peroxisomal and mitochondrial division machineries.	BIGYIN, an orthologue of human and yeast FIS1 genes functions in the control of mitochondrial size and number in Arabidopsis thaliana.2006 · DOI: 10.1093/jxb/erj096 Two small protein families, DYNAMIN-RELATED PROTEIN3 and FISSION1, are required for peroxisome fission in Arabidopsis.2009 · DOI: 10.1111/j.1365-313x.2008.03677.x FISSION1A and FISSION1B proteins mediate the fission of peroxisomes and mitochondria in Arabidopsis.2008 · DOI: 10.1093/mp/ssn056
`At5g12390`	Component of the peroxisomal and mitochondrial division machineries.	Arabidopsis PEROXIN11c-e, FISSION1b, and DYNAMIN-RELATED PROTEIN3A cooperate in cell cycle-associated replication of peroxisomes.2008 · DOI: 10.1105/tpc.107.057679 Two small protein families, DYNAMIN-RELATED PROTEIN3 and FISSION1, are required for peroxisome fission in Arabidopsis.2009 · DOI: 10.1111/j.1365-313x.2008.03677.x FISSION1A and FISSION1B proteins mediate the fission of peroxisomes and mitochondria in Arabidopsis.2008 · DOI: 10.1093/mp/ssn056

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021074 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006397 mRNA processing Biological Process

GO:0009451 RNA modification Biological Process

GO:0016554 cytidine to uridine editing Biological Process

GO:0016556 mRNA modification Biological Process

GO:0031425 chloroplast RNA processing Biological Process

GO:1900865 chloroplast RNA modification Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

GO:0004519 endonuclease activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G59720

ath:AT2G02980

ath:AT4G21065

ath:AT5G48910

ath:AT5G66520

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.614

Rank 1 · TkA01G373590 · TK1151

Peroxisome0.265

Rank 2 · TkA01G373590 · TK1151

Cytoplasm0.180

Rank 3 · TkA01G373590 · TK1151

Nucleus0.078

Rank 4 · TkA01G373590 · TK1151

Cell membrane0.055

Rank 5 · TkA01G373590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13424TPR_1236-68 aa

PF23914TPR_CcmH_CycH50-112 aa

PF07719TPR_251-67 aa

PF14559TPR_1951-71 aa

PF13428TPR_1452-70 aa

PF13374TPR_1052-67 aa

PF14852Fis1_TPR_N55-80 aa

PF14853Fis1_TPR_C90-142 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G373590	`PF13424`	TPR_12	36	68	0.0029	18.5
TkA01G373590	`PF23914`	TPR_CcmH_CycH	50	112	0.22	12.1
TkA01G373590	`PF07719`	TPR_2	51	67	9.7e-05	22.9
TkA01G373590	`PF14559`	TPR_19	51	71	0.18	12.9
TkA01G373590	`PF13428`	TPR_14	52	70	0.085	14.3
TkA01G373590	`PF13374`	TPR_10	52	67	0.27	12.0
TkA01G373590	`PF14852`	Fis1_TPR_N	55	80	4.7e-10	39.7
TkA01G373590	`PF14853`	Fis1_TPR_C	90	142	5e-22	78.5
TkA01G373590	`PF07719`	TPR_2	93	122	9.7e-05	22.9
TkA01G373590	`PF13424`	TPR_12	93	123	0.0029	18.5
TkA01G373590	`PF13428`	TPR_14	94	127	0.085	14.3
TkA01G373590	`PF14559`	TPR_19	94	132	0.18	12.9
TkA01G373590	`PF13374`	TPR_10	96	119	0.27	12.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M1J1`	Arabidopsis thaliana	sp\|Q9M1J1\|FIS1A_ARATH Mitochondrial fission 1 protein A	70.000%	Swiss-Prot	High
`Q94CK3`	Arabidopsis thaliana	sp\|Q94CK3\|FIS1B_ARATH Mitochondrial fission 1 protein B	61.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card