TkA01G363210 | RubberDandelionOmics

Gene overview

TkA01G363210

Reference: TK1151 Chr: Chr01 Coordinates: 90389696-90391295 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

849 bp · TkA01G363210|TK1151|cDNA

CGAACAATCGAGACGGGTCTTCATACCCTCGGCAAAAACCCTTGATCAGACCATTCGTCACTTGTTTCGTCCCACTCTCCGCCGGCGAAGGTGATCGTCCGTTCCGGTAGCAACGCGTTCACTGCAAGCCAGAAACTGAAACTTTTTCTTCCATCTCGTCAATCATGCAACAGTCTGGCAGTGGCTCTGAAACCGAAGTGACATGGGAGGATCAGCAAAACATCAACAAATTTGGGAGATTGAACAATCGGTACCATGAA...

CDS

Download CDS FASTA

384 bp · TkA01G363210|TK1151|CDS

ATGCAACAGTCTGGCAGTGGCTCTGAAACCGAAGTGACATGGGAGGATCAGCAAAACATCAACAAATTTGGGAGATTGAACAATCGGTACCATGAACTTGATGATGAAATAAGGATTGCCATGGAAGCAAATGAGAATTTTGAGGATGCAAGCAATGAATTGATATTAACAGATGAGGAGGTGGTGCGTTTCCAAATCGGTGAAATATTTGCTCATGTGCCAAAAGATGAAGTTGAAGCAAGAATTGAAAAAATGACGGA...

Protein

Download Protein FASTA

127 aa · TkA01G363210|TK1151|PROTEIN

MQQSGSGSETEVTWEDQQNINKFGRLNNRYHELDDEIRIAMEANENFEDASNELILTDEEVVRFQIGEIFAHVPKDEVEARIEKMTETTTQHLGKLKEEKESVVAQMAELKKVLYGKFKESINLEED

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G363210`
TK1151 ID	TkA01G363210
OH-1004 ID	LXL04_003414
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 97.638 / OH-1004 80.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G363210

Location Chr01:90389696-90391295 (-)

Description Similar to AIP3: Probable prefoldin subunit 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g08780`	Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it.	Prefoldins contribute to maintaining the levels of the spliceosome LSM2-8 complex through Hsp90 in Arabidopsis.2020 · DOI: 10.1093/nar/gkaa354

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003414 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006397 mRNA processing Biological Process

GO:0006457 protein folding Biological Process

GO:0009409 response to cold Biological Process

GO:0009631 cold acclimation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0043622 cortical microtubule organization Biological Process

GO:0071370 cellular response to gibberellin stimulus Biological Process

GO:1905907 negative regulation of amyloid fibril formation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G08780

bta:514621

ddi:DDB_G0281873

hsa:5203

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.720

Rank 1 · TkA01G363210 · TK1151

Nucleus0.564

Rank 2 · TkA01G363210 · TK1151

Mitochondrion0.068

Rank 3 · TkA01G363210 · TK1151

Cell membrane0.035

Rank 4 · TkA01G363210 · TK1151

Peroxisome0.032

Rank 5 · TkA01G363210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23770Beta-prop_RIG_1st6-110 aa

PF24459DUF75746-63 aa

PF09177STX6_10_61_N7-53 aa

PF29075NOCA1_mid12-126 aa

PF01920Prefoldin_217-120 aa

PF04325DUF46523-45 aa

PF07259ProSAAS42-83 aa

PF09177STX6_10_61_N75-113 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G363210	`PF23770`	Beta-prop_RIG_1st	6	110	0.0069	15.7
TkA01G363210	`PF24459`	DUF7574	6	63	0.2	12.5
TkA01G363210	`PF09177`	STX6_10_61_N	7	53	0.067	14.4
TkA01G363210	`PF29075`	NOCA1_mid	12	126	0.095	13.3
TkA01G363210	`PF01920`	Prefoldin_2	17	120	2e-19	70.2
TkA01G363210	`PF04325`	DUF465	23	45	0.034	14.8
TkA01G363210	`PF07259`	ProSAAS	42	83	0.28	11.9
TkA01G363210	`PF09177`	STX6_10_61_N	75	113	0.067	14.4
TkA01G363210	`PF04325`	DUF465	80	100	0.034	14.8
TkA01G363210	`PF24459`	DUF7574	87	107	0.2	12.5
TkA01G363210	`PF04325`	DUF465	106	112	0.034	14.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M4B5`	Arabidopsis thaliana	sp\|Q9M4B5\|PFD4_ARATH Prefoldin subunit 4	71.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card