TkA01G363100 | RubberDandelionOmics

Gene overview

TkA01G363100

Reference: TK1151 Chr: Chr01 Coordinates: 90357888-90371956 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5513 bp · TkA01G363100|TK1151|cDNA

TCAAGTTCCCTGCGCTTCTTTCTTGTTGTTCCCTCCGATCGCGCCTTCCGCCAGATCTCCGCCCTATTTTACCAACAATCCAAACCCTCAATCGGAGGCGCCACCGCCGTATAAACCCTAACGATCTAGAGAGTGAGAGAGAGGCAAACAAGGTGTATCCATAACCTTCTTATTAGTCTCCGTTGAAGCGTTTTAAACCTAGTCACAAGTAAGCCAGTTTCTAATCAATTCATACTTCAAGGGCGGTGATTGCTTTTTAA...

CDS

Download CDS FASTA

3468 bp · TkA01G363100|TK1151|CDS

ATGACGAGGTTTCATGTCAATGGCAAAGTAGTTGACACTGTTGATTTGCTGCGGAAGAGGCACTGGCCATGGCGATTTGATTCATGGCCATTTGCTATACTTTATGCTACGTGGATGATTGTTATCGTACCCAGCCTAGATTTCCTTGACGCATTTATAATTTTTGGTGGTCTGGTTGCTGTCCACATATTGGTGTTCCTCTTTACAGTATGGTCTGTGGATTTTAAATGTTTTGTTCAGTATTCAAAGGTTAAAGATAT...

Protein

Download Protein FASTA

1155 aa · TkA01G363100|TK1151|PROTEIN

MTRFHVNGKVVDTVDLLRKRHWPWRFDSWPFAILYATWMIVIVPSLDFLDAFIIFGGLVAVHILVFLFTVWSVDFKCFVQYSKVKDINHANACKITPAKFCGSKEVVPLNFRKLGGSSTEEIYFDFRKQCFIYSNEKKTFCKLPYPSKETIGYYLKSTGHGTEAKVQVAAEKWGRNVFEYPQPTFQKLMKEHCMEPFFVFQVFCVGLWCLDEYWYYSLFTLFMLFMFESTMAKSRLKTLSELRRVRVDSQILMVYRCGKW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G363100`
TK1151 ID	TkA01G363100
OH-1004 ID	LXL04_006297
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.300
Protein coverage (%)	TK1151 100.000 / OH-1004 99.148 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G363100

Location Chr01:90357888-90371956 (-)

Description Similar to PDR2: Probable manganese-transporting ATPase PDR2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g23630`	Mediates manganese transport into the endoplasmic reticulum.	Arabidopsis pdr2 reveals a phosphate-sensitive checkpoint in root development.2004 · DOI: 10.1111/j.1365-313x.2004.02005.x ER-resident proteins PDR2 and LPR1 mediate the developmental response of root meristems to phosphate availability.2009 · DOI: 10.1073/pnas.0901778106

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006297 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006874 intracellular calcium ion homeostasis Biological Process

GO:0009846 pollen germination Biological Process

GO:0010073 meristem maintenance Biological Process

GO:0010152 pollen maturation Biological Process

GO:0015031 protein transport Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0030003 intracellular monoatomic cation homeostasis Biological Process

GO:0030026 intracellular manganese ion homeostasis Biological Process

GO:0030435 sporulation resulting in formation of a cellular spore Biological Process

GO:0034214 protein hexamerization Biological Process

GO:0034220 monoatomic ion transmembrane transport Biological Process

GO:0043335 protein unfolding Biological Process

KEGG gene cross-reference

ath:AT5G23630

hsa:57130

mmu:170759

sce:YEL031W

spo:2542381

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.558

Rank 1 · TkA01G363100 · TK1151

Golgi apparatus0.249

Rank 2 · TkA01G363100 · TK1151

Cell membrane0.180

Rank 3 · TkA01G363100 · TK1151

Cytoplasm0.125

Rank 4 · TkA01G363100 · TK1151

Nucleus0.072

Rank 5 · TkA01G363100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF231432TM_P5A-ATPase20-85 aa

PF231432TM_P5A-ATPase196-217 aa

PF00122E1-E2_ATPase254-382 aa

PF231432TM_P5A-ATPase400-420 aa

PF00702Hydrolase479-708 aa

PF13246Cation_ATPase536-672 aa

PF00702Hydrolase762-818 aa

PF08282Hydrolase_3798-828 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G363100	`PF23143`	2TM_P5A-ATPase	20	85	2.8e-20	72.9
TkA01G363100	`PF23143`	2TM_P5A-ATPase	196	217	2.8e-20	72.9
TkA01G363100	`PF00122`	E1-E2_ATPase	254	382	3.5e-14	53.1
TkA01G363100	`PF23143`	2TM_P5A-ATPase	400	420	2.8e-20	72.9
TkA01G363100	`PF00702`	Hydrolase	479	708	2.6e-09	38.5
TkA01G363100	`PF13246`	Cation_ATPase	536	672	1.8e-12	48.1
TkA01G363100	`PF00702`	Hydrolase	762	818	2.6e-09	38.5
TkA01G363100	`PF08282`	Hydrolase_3	798	828	0.053	14.0
TkA01G363100	`PF12048`	DUF3530	826	880	0.082	12.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LT02`	Arabidopsis thaliana	sp\|Q9LT02\|PDR2_ARATH Probable manganese-transporting ATPase PDR2	75.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card