LXL04_006297 | RubberDandelionOmics

Gene overview

LXL04_006297

Reference: OH-1004 Chr: Chr02 Coordinates: 6330933-6338426 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3563 bp · LXL04_006297|LXL04_006297|OH1004|cDNA

TTCATACTTCACGGGCGGTGATTGTTTTTTAACTTGATCTGAATTCGAGTTGTAATCTCGGAAGTGAGATGACGAGGTTTCATGTCAATGGCAAAGTAGTTGACACTGTTGATTTGCTGCGGAAGAGGCACTGGCCATGGCGATTTGATTCATGGCCATTTGCTATACTTTATGCTACATGGATGATTCTTATCGTACCCAGTCTAGATTTCCTTGACGCATTTATAATTTTTGGTGGTCTGCTTGCTGTCCACATATTG...

CDS

Download CDS FASTA

3525 bp · LXL04_006297|LXL04_006297|OH1004|CDS

CTGAATTCGAGTTGTAATCTCGGAAGTGAGATGACGAGGTTTCATGTCAATGGCAAAGTAGTTGACACTGTTGATTTGCTGCGGAAGAGGCACTGGCCATGGCGATTTGATTCATGGCCATTTGCTATACTTTATGCTACATGGATGATTCTTATCGTACCCAGTCTAGATTTCCTTGACGCATTTATAATTTTTGGTGGTCTGCTTGCTGTCCACATATTGGTGTTCCTCTTTACAGTATGGTCTGTGGATTTTAAATG...

Protein

Download Protein FASTA

1174 aa · LXL04_006297|LXL04_006297|OH1004|PROTEIN

MNSSCNLGSEMTRFHVNGKVVDTVDLLRKRHWPWRFDSWPFAILYATWMILIVPSLDFLDAFIIFGGLLAVHILVFLFTVWSVDFKCFVQYSKVKDINHANACKITPAKFCGSKEVVPLNFRKVLGGSSTEEIYFDFRKQCFIYSNEKKTFCKLPYPSKETIGYYLKSTGHGTEAKVQVAAEKWGRNVFEYPQPTFQKLMKEHCMEPFFVFQVFCVGLWCLDEYWYYSLFTLFMLFMFESTMAKSRLKTLSELRRVRVDS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006297`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006297

Location Chr02:6330933-6338426 (-)

Description Similar to PDR2: Probable manganese-transporting ATPase PDR2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g23630`	Mediates manganese transport into the endoplasmic reticulum.	Arabidopsis pdr2 reveals a phosphate-sensitive checkpoint in root development.2004 · DOI: 10.1111/j.1365-313x.2004.02005.x ER-resident proteins PDR2 and LPR1 mediate the developmental response of root meristems to phosphate availability.2009 · DOI: 10.1073/pnas.0901778106

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006297 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006874 intracellular calcium ion homeostasis Biological Process

GO:0009846 pollen germination Biological Process

GO:0010073 meristem maintenance Biological Process

GO:0010152 pollen maturation Biological Process

GO:0015031 protein transport Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0030003 intracellular monoatomic cation homeostasis Biological Process

GO:0030026 intracellular manganese ion homeostasis Biological Process

GO:0030435 sporulation resulting in formation of a cellular spore Biological Process

GO:0034214 protein hexamerization Biological Process

GO:0034220 monoatomic ion transmembrane transport Biological Process

GO:0043335 protein unfolding Biological Process

KEGG gene cross-reference

ath:AT5G23630

hsa:57130

mmu:170759

sce:YEL031W

spo:2542381

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.522

Rank 1 · LXL04_006297 · OH-1004

Golgi apparatus0.253

Rank 2 · LXL04_006297 · OH-1004

Cell membrane0.198

Rank 3 · LXL04_006297 · OH-1004

Cytoplasm0.140

Rank 4 · LXL04_006297 · OH-1004

Lysosome / Vacuole0.077

Rank 5 · LXL04_006297 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23143.22TM_P5A-ATPase30-95 aa

PF00122.26E1-E2_ATPase265-393 aa

PF13246.13Cation_ATPase547-683 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006297	`PF23143.2`	2TM_P5A-ATPase	30	95	6.2e-20	71.7
LXL04_006297	`PF00122.26`	E1-E2_ATPase	265	393	1.5e-14	54.3
LXL04_006297	`PF13246.13`	Cation_ATPase	547	683	1.9e-12	48.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LT02`	Arabidopsis thaliana	Probable manganese-transporting ATPase PDR2	74.957%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card