RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G328310
Reference: TK1151 Chr: Chr01 Coordinates: 81647087-81649913 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2094 bp · TkA01G328310|TK1151|cDNA

CTCGTATATTCTTCAAACCACAATGAGATGGGTCCAATATTGTTGTACTCTACATCAATTTAGAGCTTTTTCATGTGAAGACACGATCCGGATCTGCCGCGCCTTCTCCTTTCACAATTTCCTTCTACCTTTCTCTCAGACACACAGACACACACACACACACTCTCTCTCATTCTCTCAAGAGAGAGAAAGGAGAGAGAGAGACAGGGAGAGAGAGCCTTATCTTAGATAATTTGTTCAGAACGAAAAGACCTAAGGAA...

CDS

Download CDS FASTA

1599 bp · TkA01G328310|TK1151|CDS

ATGGAGGAACAGTACGGGATAACGGATCTGACTCACTACATGAACGGAAGAGTCTTCACGGCGGTCCCTCCGCCACCATCTCAGCCTCAGCAGCCTACTCATGAGCTTCACTATGACATGGTGATGATGGGTGGTGGTGGGGGGATGATGTTTCGATCAGATTCCACCACAGGTACAGGCTCAACCACTGCTAGTCTTAGCGCCGGGGGTGGTGGGTTGGAGATGGAAATTGGTGGCGGTTTGGAGATGGAAATTGGTGG...

Protein

Download Protein FASTA

532 aa · TkA01G328310|TK1151|PROTEIN

MEEQYGITDLTHYMNGRVFTAVPPPPSQPQQPTHELHYDMVMMGGGGGMMFRSDSTTGTGSTTASLSAGGGGLEMEIGGGLEMEIGGGGGGGNGRWPRQETLTLLEVRSRLDSKFKEANQKGPLWDEVSRIMCEEHGYQRSGKKCREKFENLYKYYKKTKEGKAGRQDGKHYRFFRQLEALYGESSTSINPNPNPNPASFSDPHNFNVETSAFQGHPHPNNISYNQEAFQTAPSRLGDDSPSLSNNSSAFDTSSSGYSNP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G328310
TK1151 IDTkA01G328310
OH-1004 IDLXL04_032559
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)51.000
Protein coverage (%)TK1151 99.248 / OH-1004 99.367
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G328310
LocationChr01:81647087-81649913 (+)
DescriptionSimilar to PTL: Trihelix transcription factor PTL
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g03680 Transcription factor that prevents growth. No verified direct reference in this release
At1g76880 Transcription repressor that negatively regulates root hair growth by directly binding RSL4 promoter and repressing RSL4 expression. No verified direct reference in this release
At1g76890 Probable transcription factor that binds specific DNA sequence. No verified direct reference in this release
At1g33240 Transcription repressor that binds specific DNA sequence such as GT3 box 5'-GGTAAA-3' in the SDD1 promoter.
The trihelix transcription factor GTL1 regulates ploidy-dependent cell growth in the Arabidopsis trichome.2009 · DOI: 10.1105/tpc.109.068387
The Arabidopsis GTL1 transcription factor regulates water use efficiency and drought tolerance by modulating stomatal density via transrepression of SDD1.2010 · DOI: 10.1105/tpc.110.078691
GTL1 and DF1 regulate root hair growth through transcriptional repression of ROOT HAIR DEFECTIVE 6-LIKE 4 in Arabidopsis.2018 · DOI: 10.1242/dev.159707
At5g28300 Probable transcription factor that binds specific DNA sequence. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_032559 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0009909 regulation of flower development Biological Process
GO:0019760 glucosinolate metabolic process Biological Process
GO:0046621 negative regulation of organ growth Biological Process
GO:0048354 mucilage biosynthetic process involved in seed coat development Biological Process
GO:0048358 mucilage pectin biosynthetic process Biological Process
GO:0048441 petal development Biological Process
GO:0048442 sepal development Biological Process
GO:0048498 establishment of petal orientation Biological Process
GO:0048768 root hair cell tip growth Biological Process
GO:0090428 perianth development Biological Process
KEGG gene cross-reference
ath:AT1G76880
ath:AT1G76890
ath:AT5G03680
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.983
Rank 1 · TkA01G328310 · TK1151
Cytoplasm0.062
Rank 2 · TkA01G328310 · TK1151
Cell membrane0.023
Rank 3 · TkA01G328310 · TK1151
Endoplasmic reticulum0.015
Rank 4 · TkA01G328310 · TK1151
Plastid0.010
Rank 5 · TkA01G328310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13837Myb_DNA-bind_495-181 aa
PF16282SANT_DAMP1_like95-115 aa
PF10545MADF_DNA_bdg113-181 aa
PF10733DUF2525166-178 aa
PF16282SANT_DAMP1_like282-311 aa
PF10173Mit_KHE1282-373 aa
PF27871CLB_0814_fam287-331 aa
PF10545MADF_DNA_bdg303-316 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G328310PF13837Myb_DNA-bind_4951819.7e-35119.6
TkA01G328310PF16282SANT_DAMP1_like951150.7510.8
TkA01G328310PF10545MADF_DNA_bdg1131810.01116.8
TkA01G328310PF10733DUF25251661780.1913.1
TkA01G328310PF16282SANT_DAMP1_like2823110.7510.8
TkA01G328310PF10173Mit_KHE12823731.49.7
TkA01G328310PF27871CLB_0814_fam2873310.1412.9
TkA01G328310PF10545MADF_DNA_bdg3033160.01116.8
TkA01G328310PF13837Myb_DNA-bind_43083289.7e-35119.6
TkA01G328310PF16282SANT_DAMP1_like3143350.7510.8
TkA01G328310PF13837Myb_DNA-bind_43483689.7e-35119.6
TkA01G328310PF10733DUF25253573940.1913.1
TkA01G328310PF16282SANT_DAMP1_like3904110.7510.8
TkA01G328310PF13837Myb_DNA-bind_43914709.7e-35119.6
TkA01G328310PF10545MADF_DNA_bdg4214670.01116.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LZS0Arabidopsis thalianasp|Q9LZS0|PTL_ARATH Trihelix transcription factor PTL44.900%Swiss-ProtMedium
Q9C6K3Arabidopsis thalianasp|Q9C6K3|DF1_ARATH Trihelix transcription factor DF133.900%Swiss-ProtMedium
Q39117Arabidopsis thalianasp|Q39117|TGT2_ARATH Trihelix transcription factor GT-229.000%Swiss-ProtLow
Q9C882Arabidopsis thalianasp|Q9C882|GTL1_ARATH Trihelix transcription factor GTL163.200%Swiss-ProtLow
Q8H181Arabidopsis thalianasp|Q8H181|GTL2_ARATH Trihelix transcription factor GTL238.500%Swiss-ProtLow

JBrowse

View in Genome Browser