TkA01G321850 | RubberDandelionOmics

Gene overview

TkA01G321850

Reference: TK1151 Chr: Chr01 Coordinates: 80003790-80004975 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

399 bp · TkA01G321850|TK1151|cDNA

ATGGCAGTGGGGTTTAGGATAATGTGGTGTTGCTACTATGGTTCGAAGAAAAGAGGGTTGTCATTGGAAGAAAAGCGGGAAAAGATGCTTCAAATCTTTTACGACTCCCAAGATTTTTACCTTCTCAAAGAACTTGAAAAGTTGGGCCCTAGAAAAGGCGTTATCAGCCAATCTGTCAAAGATGTTGTCCAAACTCTAGTGGATGATGACTTGGTCTCAAAAGACAAGATAGGAACCTCGGTATACTTTTGGAGTCTTCC...

CDS

Download CDS FASTA

399 bp · TkA01G321850|TK1151|CDS

ATGGCAGTGGGGTTTAGGATAATGTGGTGTTGCTACTATGGTTCGAAGAAAAGAGGGTTGTCATTGGAAGAAAAGCGGGAAAAGATGCTTCAAATCTTTTACGACTCCCAAGATTTTTACCTTCTCAAAGAACTTGAAAAGTTGGGCCCTAGAAAAGGCGTTATCAGCCAATCTGTCAAAGATGTTGTCCAAACTCTAGTGGATGATGACTTGGTCTCAAAAGACAAGATAGGAACCTCGGTATACTTTTGGAGTCTTCC...

Protein

Download Protein FASTA

132 aa · TkA01G321850|TK1151|PROTEIN

MAVGFRIMWCCYYGSKKRGLSLEEKREKMLQIFYDSQDFYLLKELEKLGPRKGVISQSVKDVVQTLVDDDLVSKDKIGTSVYFWSLPSCAGNQLRNMSKKSESDLEISKKRHMELVEQCESLKKGREGFSKL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G321850`
TK1151 ID	TkA01G321850
OH-1004 ID	LXL04_002469
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.200
Protein coverage (%)	TK1151 96.212 / OH-1004 51.210 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G321850

Location Chr01:80003790-80004975 (+)

Description Similar to MND1: Meiotic nuclear division protein 1 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g29170`	Required for proper homologous chromosome pairing and efficient cross-over and intragenic recombination during meiosis.	The Arabidopsis thaliana MND1 homologue plays a key role in meiotic homologous pairing, synapsis and recombination.2006 · DOI: 10.1242/jcs.02967 AtMND1 is required for homologous pairing during meiosis in Arabidopsis.2006 · DOI: 10.1186/1471-2199-7-24 The interplay of RecA-related proteins and the MND1-HOP2 complex during meiosis in Arabidopsis thaliana.2007 · DOI: 10.1371/journal.pgen.0030176

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002469 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006302 double-strand break repair Biological Process

GO:0007129 homologous chromosome pairing at meiosis Biological Process

GO:0007131 reciprocal meiotic recombination Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009555 pollen development Biological Process

GO:0010212 response to ionizing radiation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0003690 double-stranded DNA binding Molecular Function

KEGG gene cross-reference

ath:AT4G29170

bta:618239

hsa:84057

mmu:76915

xla:108699336

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.651

Rank 1 · TkA01G321850 · TK1151

Cytoplasm0.369

Rank 2 · TkA01G321850 · TK1151

Endoplasmic reticulum0.042

Rank 3 · TkA01G321850 · TK1151

Mitochondrion0.038

Rank 4 · TkA01G321850 · TK1151

Cell membrane0.035

Rank 5 · TkA01G321850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29076ERG29_C18-79 aa

PF18842LPD2627-35 aa

PF03962Mnd129-87 aa

PF18842LPD2655-73 aa

PF29076ERG29_C103-122 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G321850	`PF29076`	ERG29_C	18	79	0.2	12.4
TkA01G321850	`PF18842`	LPD26	27	35	0.19	12.6
TkA01G321850	`PF03962`	Mnd1	29	87	1.2e-25	90.2
TkA01G321850	`PF18842`	LPD26	55	73	0.19	12.6
TkA01G321850	`PF29076`	ERG29_C	103	122	0.2	12.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GYD2`	Arabidopsis thaliana	sp\|Q8GYD2\|MND1_ARATH Meiotic nuclear division protein 1 homolog	81.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card