TkA01G320930 | RubberDandelionOmics

Gene overview

TkA01G320930

Reference: TK1151 Chr: Chr01 Coordinates: 79703613-79705351 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

429 bp · TkA01G320930|TK1151|cDNA

ATGTCGTATTTGCTGCCGCACCTTCACTCTGGATGGGCCGTCGATCAGGCTATTCTCGCTGAGGAAGAACGCCTTGTCATCATCCGTTTCGGCCACGATTGGGACGAAACCTGTATGCAGATGGATGAGGTGCTTGCTGCAGTCGCCGAAACGATAAAGAACTTTGCTGTCATATACCTAGTTGATATCACAGAGGTGCCCGATTTCAACACAATGTATGAGTTGTATGACCCTTCGACAGTAATGTTCTTCTTCAGGAA...

CDS

Download CDS FASTA

429 bp · TkA01G320930|TK1151|CDS

ATGTCGTATTTGCTGCCGCACCTTCACTCTGGATGGGCCGTCGATCAGGCTATTCTCGCTGAGGAAGAACGCCTTGTCATCATCCGTTTCGGCCACGATTGGGACGAAACCTGTATGCAGATGGATGAGGTGCTTGCTGCAGTCGCCGAAACGATAAAGAACTTTGCTGTCATATACCTAGTTGATATCACAGAGGTGCCCGATTTCAACACAATGTATGAGTTGTATGACCCTTCGACAGTAATGTTCTTCTTCAGGAA...

Protein

Download Protein FASTA

142 aa · TkA01G320930|TK1151|PROTEIN

MSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDWDETCMQMDEVLAAVAETIKNFAVIYLVDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWAMKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G320930`
TK1151 ID	TkA01G320930
OH-1004 ID	LXL04_008275
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G320930

Location Chr01:79703613-79705351 (+)

Description Similar to YLS8: Thioredoxin-like protein YLS8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g08290`	Thioredoxin-like protein YLS8.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008275 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000245 spliceosomal complex assembly Biological Process

GO:0000375 RNA splicing, via transesterification reactions Biological Process

GO:0000387 spliceosomal snRNP assembly Biological Process

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0045292 mRNA cis splicing, via spliceosome Biological Process

GO:0051301 cell division Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005681 spliceosomal complex Cellular Component

GO:0005682 U5 snRNP Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ago:AGOS_ADL374W

ath:AT5G08290

hsa:10907

mmu:27366

spo:2539369

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.610

Rank 1 · TkA01G320930 · TK1151

Nucleus0.360

Rank 2 · TkA01G320930 · TK1151

Cell membrane0.099

Rank 3 · TkA01G320930 · TK1151

Lysosome / Vacuole0.069

Rank 4 · TkA01G320930 · TK1151

Endoplasmic reticulum0.066

Rank 5 · TkA01G320930 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02966DIM14-136 aa

PF31190Lys_phage8-44 aa

PF13899Thioredoxin_714-51 aa

PF00085Thioredoxin17-102 aa

PF31190Lys_phage88-125 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G320930	`PF02966`	DIM1	4	136	1.8e-68	229.2
TkA01G320930	`PF31190`	Lys_phage	8	44	0.004	17.9
TkA01G320930	`PF13899`	Thioredoxin_7	14	51	0.022	15.6
TkA01G320930	`PF00085`	Thioredoxin	17	102	9.1e-06	26.3
TkA01G320930	`PF31190`	Lys_phage	88	125	0.004	17.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FE62`	Arabidopsis thaliana	sp\|Q9FE62\|YLS8_ARATH Thioredoxin-like protein YLS8	96.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card