LXL04_008275 | RubberDandelionOmics

Gene overview

LXL04_008275

Reference: OH-1004 Chr: Chr02 Coordinates: 95355177-95355855 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

429 bp · LXL04_008275|LXL04_008275|OH1004|cDNA

atgtCGTACTTGCTACCGCACTTGCACTCCGGCTGGGCTGTCGATCAGGCGATCCTCGCCGAGGAGGAACGTCTCGTCGTTATCCGGTTCGGCCATGATTGGGACGAAACTTGTATGCAGATGGATGAAGTGCTTGCTTCAGTTGCAGAGACGATAAAGAACTTTGCTGTGATATACTTGGTGGACATCACTGAGGTACCTGACTTCAATACAATGTATGAGCTATACGATCCATCTACTGTGATGTTCTTCTTCAGGAA...

CDS

Download CDS FASTA

429 bp · LXL04_008275|LXL04_008275|OH1004|CDS

ATGTCGTACTTGCTACCGCACTTGCACTCCGGCTGGGCTGTCGATCAGGCGATCCTCGCCGAGGAGGAACGTCTCGTCGTTATCCGGTTCGGCCATGATTGGGACGAAACTTGTATGCAGATGGATGAAGTGCTTGCTTCAGTTGCAGAGACGATAAAGAACTTTGCTGTGATATACTTGGTGGACATCACTGAGGTACCTGACTTCAATACAATGTATGAGCTATACGATCCATCTACTGTGATGTTCTTCTTCAGGAA...

Protein

Download Protein FASTA

142 aa · LXL04_008275|LXL04_008275|OH1004|PROTEIN

MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDWDETCMQMDEVLASVAETIKNFAVIYLVDITEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWAMKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008275`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008275

Location Chr02:95355177-95355855 (+)

Description Similar to YLS8: Thioredoxin-like protein YLS8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g08290`	Thioredoxin-like protein YLS8.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008275 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000245 spliceosomal complex assembly Biological Process

GO:0000375 RNA splicing, via transesterification reactions Biological Process

GO:0000387 spliceosomal snRNP assembly Biological Process

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0045292 mRNA cis splicing, via spliceosome Biological Process

GO:0051301 cell division Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005681 spliceosomal complex Cellular Component

GO:0005682 U5 snRNP Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ago:AGOS_ADL374W

ath:AT5G08290

hsa:10907

mmu:27366

spo:2539369

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.598

Rank 1 · LXL04_008275 · OH-1004

Nucleus0.355

Rank 2 · LXL04_008275 · OH-1004

Cell membrane0.101

Rank 3 · LXL04_008275 · OH-1004

Lysosome / Vacuole0.075

Rank 4 · LXL04_008275 · OH-1004

Endoplasmic reticulum0.070

Rank 5 · LXL04_008275 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02966.23DIM14-136 aa

PF00085.27Thioredoxin17-102 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008275	`PF02966.23`	DIM1	4	136	5.3e-69	230.9
LXL04_008275	`PF00085.27`	Thioredoxin	17	102	5.5e-06	27.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FE62`	Arabidopsis thaliana	Thioredoxin-like protein YLS8	97.887%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card