TkA01G320790 | RubberDandelionOmics

Gene overview

TkA01G320790

Reference: TK1151 Chr: Chr01 Coordinates: 79638421-79640931 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

666 bp · TkA01G320790|TK1151|cDNA

ATGCTTCCTCTTTCGCCCAGTAATGGATTCAAACCATTAAGCTGCACAAAACGTGTTTTTGACGATAATGAGCATTACTTCAGCAGAAAGTCGTTGAAGAACTGGGACAAGTTTTACAAGCGTCACCAAAACAAGTTTTTCAAGGACAGGCATTATTTGGAGAAAGATTGGGGCACTTATTTCTCTGATATTGATGATAAAGGGAAAGCGCACTCAGATTTTGATGAGAATCGGATAAATGTTTTCATTTGTGATGTCAC...

CDS

Download CDS FASTA

666 bp · TkA01G320790|TK1151|CDS

ATGCTTCCTCTTTCGCCCAGTAATGGATTCAAACCATTAAGCTGCACAAAACGTGTTTTTGACGATAATGAGCATTACTTCAGCAGAAAGTCGTTGAAGAACTGGGACAAGTTTTACAAGCGTCACCAAAACAAGTTTTTCAAGGACAGGCATTATTTGGAGAAAGATTGGGGCACTTATTTCTCTGATATTGATGATAAAGGGAAAGCGCACTCAGATTTTGATGAGAATCGGATAAATGTTTTCATTTGTGATGTCAC...

Protein

Download Protein FASTA

221 aa · TkA01G320790|TK1151|PROTEIN

MLPLSPSNGFKPLSCTKRVFDDNEHYFSRKSLKNWDKFYKRHQNKFFKDRHYLEKDWGTYFSDIDDKGKAHSDFDENRINVFICDVTSEELSDKILPSSVDLVTLIFMLSAVSPNKMPFVLQNLKKILKPNGRILVRDYAVGDSAQMKLEIRNQIISNNFYFRGDGTCSYYFSEEFLSNLFVEAGFSIVDMSTYCRQVENRSQNMTFHRRWIRAIFNKDVL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G320790`
TK1151 ID	TkA01G320790
OH-1004 ID	LXL04_032209
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	50.000
Protein coverage (%)	TK1151 86.878 / OH-1004 50.554 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G320790`
Location	Chr01:79638421-79640931 (+)
Description	Similar to METTL6: tRNA N(3)-methylcytidine methyltransferase METTL6
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_032209` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006400 tRNA modification Biological Process GO:0030488 tRNA methylation Biological Process GO:0106217 tRNA C3-cytosine methylation Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0043527 tRNA methyltransferase complex Cellular Component GO:0019899 enzyme binding Molecular Function GO:0052735 tRNA (cytidine-3-)-methyltransferase activity Molecular Function
KEGG gene cross-reference	hsa:131965 mmu:67011 pon:100171853 rno:290564 spo:2541032 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.636

Rank 1 · TkA01G320790 · TK1151

Nucleus0.462

Rank 2 · TkA01G320790 · TK1151

Mitochondrion0.071

Rank 3 · TkA01G320790 · TK1151

Peroxisome0.041

Rank 4 · TkA01G320790 · TK1151

Cell membrane0.034

Rank 5 · TkA01G320790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08242Methyltransf_1274-134 aa

PF13649Methyltransf_2574-132 aa

PF13847Methyltransf_3178-145 aa

PF01234NNMT_PNMT_TEMT80-137 aa

PF08241Methyltransf_1181-135 aa

PF00891Methyltransf_290-187 aa

PF13489Methyltransf_2391-189 aa

PF20922Anamorsin_N97-151 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G320790	`PF08242`	Methyltransf_12	74	134	1.5e-05	26.3
TkA01G320790	`PF13649`	Methyltransf_25	74	132	0.003	18.9
TkA01G320790	`PF13847`	Methyltransf_31	78	145	0.011	16.2
TkA01G320790	`PF01234`	NNMT_PNMT_TEMT	80	137	0.0073	16.2
TkA01G320790	`PF08241`	Methyltransf_11	81	135	0.0037	18.6
TkA01G320790	`PF00891`	Methyltransf_2	90	187	0.012	15.7
TkA01G320790	`PF13489`	Methyltransf_23	91	189	8.7e-09	36.0
TkA01G320790	`PF20922`	Anamorsin_N	97	151	0.03	14.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card