LXL04_032209 | RubberDandelionOmics

Gene overview

LXL04_032209

Reference: OH-1004 Chr: Chr07 Coordinates: 18667252-18670884 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1356 bp · LXL04_032209|LXL04_032209|OH1004|cDNA

ATGATGACCATGGCGGTCTTTTCTCCCGCCATTTCAGTCTCGCCGTCGTACACCTATTATCCCATAACGCCACTCCTACTCCCACCATCTCCGTCCGTCGAATACCATCCACGATCCACCTCTGTTCAATTAAAATGTTTAGGGTTTCACAATGGTTTTGATGTCGACCAATGTAACCACAACTCCAAAATGCGCTGGGACGAGTTCTACGAGCGCCATCAAAACAAGTTTACAGCTTCTATATTGGGGGAATTTCATTC...

CDS

Download CDS FASTA

1356 bp · LXL04_032209|LXL04_032209|OH1004|CDS

ATGATGACCATGGCGGTCTTTTCTCCCGCCATTTCAGTCTCGCCGTCGTACACCTATTATCCCATAACGCCACTCCTACTCCCACCATCTCCGTCCGTCGAATACCATCCACGATCCACCTCTGTTCAATTAAAATGTTTAGGGTTTCACAATGGTTTTGATGTCGACCAATGTAACCACAACTCCAAAATGCGCTGGGACGAGTTCTACGAGCGCCATCAAAACAAGTTTACAGCTTCTATATTGGGGGAATTTCATTC...

Protein

Download Protein FASTA

451 aa · LXL04_032209|LXL04_032209|OH1004|PROTEIN

MMTMAVFSPAISVSPSYTYYPITPLLLPPSPSVEYHPRSTSVQLKCLGFHNGFDVDQCNHNSKMRWDEFYERHQNKFTASILGEFHSIIQQTNLMNFSRIGIYLEKDWGQYFCNDDTIILEVDSSFPVKVYIQILKSIPDRLTSVHPVGTDVPVSLTCHKPKVSYRRTRAMAVFPPAISVSPSYTYYPITPLLPSTISVRQIHSSSFQLKCFGLHGGFDVDRYNQNSKMHWDEFYERHQNKFFKDRHYLEKDWGQYFCND...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032209`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_032209`
Location	Chr07:18667252-18670884 (+)
Description	Similar to METTL6: tRNA N(3)-methylcytidine methyltransferase METTL6
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_032209` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006400 tRNA modification Biological Process GO:0030488 tRNA methylation Biological Process GO:0106217 tRNA C3-cytosine methylation Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0043527 tRNA methyltransferase complex Cellular Component GO:0019899 enzyme binding Molecular Function GO:0052735 tRNA (cytidine-3-)-methyltransferase activity Molecular Function
KEGG gene cross-reference	hsa:131965 mmu:67011 pon:100171853 rno:290564 spo:2541032 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.587

Rank 1 · LXL04_032209 · OH-1004

Nucleus0.344

Rank 2 · LXL04_032209 · OH-1004

Mitochondrion0.110

Rank 3 · LXL04_032209 · OH-1004

Cell membrane0.067

Rank 4 · LXL04_032209 · OH-1004

Endoplasmic reticulum0.066

Rank 5 · LXL04_032209 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13489.13Methyltransf_23258-422 aa

PF13847.13Methyltransf_31260-381 aa

PF13649.13Methyltransf_25264-364 aa

PF08242.19Methyltransf_12265-366 aa

PF08241.19Methyltransf_11265-367 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032209	`PF13489.13`	Methyltransf_23	258	422	8.7e-12	45.8
LXL04_032209	`PF13847.13`	Methyltransf_31	260	381	2.5e-10	41.0
LXL04_032209	`PF13649.13`	Methyltransf_25	264	364	1.1e-12	49.2
LXL04_032209	`PF08242.19`	Methyltransf_12	265	366	2e-14	54.8
LXL04_032209	`PF08241.19`	Methyltransf_11	265	367	1.7e-10	42.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card