TkA01G320730 | RubberDandelionOmics

Gene overview

TkA01G320730

Reference: TK1151 Chr: Chr01 Coordinates: 79620560-79621197 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

555 bp · TkA01G320730|TK1151|cDNA

ATGCTTGTGTGGGTGGAACCAGTGTTCGTGAAGATCAGCGCATTCTTTCAGCTGGGGTACATGTCGTTGTTGGAACCCCTGGTCGTGTCTTTGACATGTTACGTAGGCAGTCACTTCGTTCTGATTACATCAAAAATGTTTGTATTGGATGAGGCCGATGAAATGTTGTCTCGAGGTTTTAAGGATCAGATATACGATATTTTCCAGTTGCTGCCAGCTAAGGTGCAAGTTGGGGTGTTCTCCGCCACAATGCCACCAGA...

CDS

Download CDS FASTA

555 bp · TkA01G320730|TK1151|CDS

ATGCTTGTGTGGGTGGAACCAGTGTTCGTGAAGATCAGCGCATTCTTTCAGCTGGGGTACATGTCGTTGTTGGAACCCCTGGTCGTGTCTTTGACATGTTACGTAGGCAGTCACTTCGTTCTGATTACATCAAAAATGTTTGTATTGGATGAGGCCGATGAAATGTTGTCTCGAGGTTTTAAGGATCAGATATACGATATTTTCCAGTTGCTGCCAGCTAAGGTGCAAGTTGGGGTGTTCTCCGCCACAATGCCACCAGA...

Protein

Download Protein FASTA

184 aa · TkA01G320730|TK1151|PROTEIN

MLVWVEPVFVKISAFFQLGYMSLLEPLVVSLTCYVGSHFVLITSKMFVLDEADEMLSRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEDWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNNPRHHYA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G320730`
TK1151 ID	TkA01G320730
OH-1004 ID	LXL04_018595
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.200
Protein coverage (%)	TK1151 72.283 / OH-1004 32.203 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G320730

Location Chr01:79620560-79621197 (-)

Description Similar to Eukaryotic initiation factor 4A-15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g72730`	ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and is required for mRNA binding to ribosome.	No verified direct reference in this release
`At1g54270`	ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and is required for mRNA binding to ribosome.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0146600`	ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and is required for mRNA binding to ribosome.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018595 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002183 cytoplasmic translational initiation Biological Process

GO:0010494 cytoplasmic stress granule Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003724 RNA helicase activity Molecular Function

GO:0003743 translation initiation factor activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

KEGG gene cross-reference

nta:107783884

nta:107787142

nta:107814763

nta:107821770

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.523

Rank 1 · TkA01G320730 · TK1151

Nucleus0.469

Rank 2 · TkA01G320730 · TK1151

Mitochondrion0.079

Rank 3 · TkA01G320730 · TK1151

Endoplasmic reticulum0.075

Rank 4 · TkA01G320730 · TK1151

Golgi apparatus0.045

Rank 5 · TkA01G320730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00270DEAD43-88 aa

PF00271Helicase_C69-105 aa

PF00271Helicase_C127-178 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G320730	`PF00270`	DEAD	43	88	2.5e-10	41.1
TkA01G320730	`PF00271`	Helicase_C	69	105	9.7e-06	26.5
TkA01G320730	`PF00271`	Helicase_C	127	178	9.7e-06	26.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CAI7`	Arabidopsis thaliana	sp\|Q9CAI7\|IF4A3_ARATH Eukaryotic initiation factor 4A-3	97.700%	Swiss-Prot	High
`P41377`	Arabidopsis thaliana	sp\|P41377\|IF4A2_ARATH Eukaryotic initiation factor 4A-2	97.700%	Swiss-Prot	High
`Q6Z2Z4`	Oryza sativa subsp. japonica	sp\|Q6Z2Z4\|IF4A3_ORYSJ Eukaryotic initiation factor 4A-3	97.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card