TkA01G318800 | RubberDandelionOmics

Gene overview

TkA01G318800

Reference: TK1151 Chr: Chr01 Coordinates: 79145489-79149740 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1087 bp · TkA01G318800|TK1151|cDNA

AAACACACAACACATACACACGCACACCCCACCACATCAACAAACCCCACAGACACATTCCCAATAACTTGTACGGACACATGCACTACAAATACAAACCCCACTAGGAAGAAAAACAAGTTCATGTATGTTTGTAGTGCTATAGTAGTTGTATACTTTTAGGTAATCAAGAGGTATGGAAGGGTCTGAAAGAGGGTTAGCCATCTTTGATCTTCAAGTCTCTTCCTTCCCGAACCCCATCCATGATCATATGGGTTTCC...

CDS

Download CDS FASTA

381 bp · TkA01G318800|TK1151|CDS

ATGGATCCAAAGGCTGTTAACGAAGAAAAGTTTACAGATGATCACACTTCATGGTGGAGGAGTTCATCAAACCCTGAGAAGGGGAGAACGAAAATGAGAAGAAAGCTGCGAGAACCAAGATTCTGCTTTCAGACAAGGAGTGATGTTGATGTTCTTGATGATGGTTACAAATGGAGGAAATATGGCCAGAAAGTTGTCAAAAATAGCCTTCATCCCAGAAGCTACTATCGCTGTACACACAGTAATTGTCGGGTGAAGAA...

Protein

Download Protein FASTA

126 aa · TkA01G318800|TK1151|PROTEIN

MDPKAVNEEKFTDDHTSWWRSSSNPEKGRTKMRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHECFTSF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G318800`
TK1151 ID	TkA01G318800
OH-1004 ID	LXL04_033548
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 56.757 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G318800

Location Chr01:79145489-79149740 (+)

Description Similar to WRKY12: Probable WRKY transcription factor 12

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g44745`	Transcription factor.	No verified direct reference in this release
`At4g39410`	Transcription factor.	No verified direct reference in this release
`At1g69310`	Transcription factor.	No verified direct reference in this release
`At2g46130`	Transcription factor.	No verified direct reference in this release
`At5g41570`	Transcription factor.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033548 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009832 plant-type cell wall biogenesis Biological Process

GO:0009938 negative regulation of gibberellic acid mediated signaling pathway Biological Process

KEGG gene cross-reference

ath:AT1G69310

ath:AT2G44745

ath:AT4G39410

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.923

Rank 1 · TkA01G318800 · TK1151

Cytoplasm0.159

Rank 2 · TkA01G318800 · TK1151

Mitochondrion0.027

Rank 3 · TkA01G318800 · TK1151

Cell membrane0.024

Rank 4 · TkA01G318800 · TK1151

Endoplasmic reticulum0.011

Rank 5 · TkA01G318800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03106WRKY53-109 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G318800	`PF03106`	WRKY	53	109	2.3e-26	92.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93WY4`	Arabidopsis thaliana	sp\|Q93WY4\|WRK12_ARATH Probable WRKY transcription factor 12	82.100%	Swiss-Prot	High
`Q9SVB7`	Arabidopsis thaliana	sp\|Q9SVB7\|WRK13_ARATH Probable WRKY transcription factor 13	75.500%	Swiss-Prot	High
`Q9C983`	Arabidopsis thaliana	sp\|Q9C983\|WRK57_ARATH Probable WRKY transcription factor 57	65.900%	Swiss-Prot	Medium
`Q8GY11`	Arabidopsis thaliana	sp\|Q8GY11\|WRK43_ARATH Probable WRKY transcription factor 43	65.400%	Swiss-Prot	Medium
`Q9FFS3`	Arabidopsis thaliana	sp\|Q9FFS3\|WRK24_ARATH Probable WRKY transcription factor 24	62.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card