LXL04_033548 | RubberDandelionOmics

Gene overview

LXL04_033548

Reference: OH-1004 Chr: Chr07 Coordinates: 47457245-47461108 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

669 bp · LXL04_033548|LXL04_033548|OH1004|cDNA

ATGGAAGGGTCTGAAAGAGGGTTAGCCATCTTTGATCTTCAAGTCTCTTCCTTCCCGAACCCCATCCATGATCATATGGGTTTTCCCCACTTTCAAGATCATCACCATAATCATCATGATCCTCACCATAGCCAAGTTTTAAGGTTCATGCCTCCAACTCTCTCTCTTCCTCACTTATCTCAACCACCTCACCACAataccaccaccacctccaccgACGCTGCCGCCTTCAACAGCGACGCTGTCCCAGTTCATAGAGA...

CDS

Download CDS FASTA

669 bp · LXL04_033548|LXL04_033548|OH1004|CDS

ATGGAAGGGTCTGAAAGAGGGTTAGCCATCTTTGATCTTCAAGTCTCTTCCTTCCCGAACCCCATCCATGATCATATGGGTTTTCCCCACTTTCAAGATCATCACCATAATCATCATGATCCTCACCATAGCCAAGTTTTAAGGTTCATGCCTCCAACTCTCTCTCTTCCTCACTTATCTCAACCACCTCACCACAATACCACCACCACCTCCACCGACGCTGCCGCCTTCAACAGCGACGCTGTCCCAGTTCATAGAGA...

Protein

Download Protein FASTA

222 aa · LXL04_033548|LXL04_033548|OH1004|PROTEIN

MEGSERGLAIFDLQVSSFPNPIHDHMGFPHFQDHHHNHHDPHHSQVLRFMPPTLSLPHLSQPPHHNTTTTSTDAAAFNSDAVPVHRDSWHKEQVGSMDPKAVNEEKFTDDHTSWWRSSSNPEKGRTKMRRKLREPRFCFQTRSDVDVLDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHNHSPCDDSNSSEHECFTSF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033548`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033548

Location Chr07:47457245-47461108 (+)

Description Similar to WRKY12: Probable WRKY transcription factor 12

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g44745`	Transcription factor.	No verified direct reference in this release
`At4g39410`	Transcription factor.	No verified direct reference in this release
`At1g69310`	Transcription factor.	No verified direct reference in this release
`At2g46130`	Transcription factor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q6B6R4`	Transcription repressor (By similarity).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033548 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009832 plant-type cell wall biogenesis Biological Process

GO:0009938 negative regulation of gibberellic acid mediated signaling pathway Biological Process

KEGG gene cross-reference

ath:AT1G69310

ath:AT2G44745

ath:AT4G39410

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.976

Rank 1 · LXL04_033548 · OH-1004

Cytoplasm0.077

Rank 2 · LXL04_033548 · OH-1004

Cell membrane0.028

Rank 3 · LXL04_033548 · OH-1004

Endoplasmic reticulum0.021

Rank 4 · LXL04_033548 · OH-1004

Plastid0.011

Rank 5 · LXL04_033548 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03106.22WRKY149-205 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033548	`PF03106.22`	WRKY	149	205	6e-26	91.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93WY4`	Arabidopsis thaliana	Probable WRKY transcription factor 12	72.464%	Swiss-Prot	moderate database homology
`Q9SVB7`	Arabidopsis thaliana	Probable WRKY transcription factor 13	73.958%	Swiss-Prot	weak database homology
`Q9C983`	Arabidopsis thaliana	Probable WRKY transcription factor 57	65.882%	Swiss-Prot	weak database homology
`Q8GY11`	Arabidopsis thaliana	Probable WRKY transcription factor 43	65.432%	Swiss-Prot	weak database homology
`Q6B6R4`	Oryza sativa subsp. indica	WRKY transcription factor WRKY24	50.820%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card