RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G305600
Reference: TK1151 Chr: Chr01 Coordinates: 75893187-75899196 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3112 bp · TkA01G305600|TK1151|cDNA

TTCAGATGCCAAAACTAGCCCTCAACGGATGATACCTTGATCCAATAACAATGCTATCTATTTCAGATTAAAAAACGCCAAAACCGTGAGTTAACTCAGCAGATGATATATTCTAGTCCAATAATGTATTTTGTAGCTTATTACGGGAAAGGACAAACGCACCCTCACAATACTTTCAAATACCAAAAATACCCCTGTTCCCTGTCTCCTTCCCCTGCTCGATCTGGTCTTTCTTCCATCTGCGATTGTCACTGGATTAG...

CDS

Download CDS FASTA

2376 bp · TkA01G305600|TK1151|CDS

ATGCCGATGGAGCCAGAATCTGGCGCCTTAACTTCTCGAAACCCTTCTCAGTTTTTCTTGAATTTATCGCGCAATTTGTTGTTGGCATATCAAAGCTTTGGTGTGGTGTATGGAGACTTGGGCACTTCACCTCTTTATGTGTATAGAAGCGTGTTTGTTGAGAATCTCAAGGATCATCAGACTCCAGAAGTTATATTTGGGGCATTCTCTTTGATATTTTGGACCTTAACTCTAATCCCTTTGCTAAAATATGTCTTAAT...

Protein

Download Protein FASTA

791 aa · TkA01G305600|TK1151|PROTEIN

MPMEPESGALTSRNPSQFFLNLSRNLLLAYQSFGVVYGDLGTSPLYVYRSVFVENLKDHQTPEVIFGAFSLIFWTLTLIPLLKYVLIILSADDNGEGGTIALYSLLCRHAKFSLLPNQQAADEELTSYKYGPSQSQLQSPSPLSSPSPLKRFLEKHKKLRTYLLLVVLLGASMLIADGVITPAISVMSAVSGLEIEGVGLDLTHGEVVLLSCVILIGLFALQHTGTQRVAIVFAPIVIVWLITIFGIGLYNIIHWNPKII...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G305600
TK1151 IDTkA01G305600
OH-1004 IDLXL04_032319
Relationship / confidenceRbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)76.400
Protein coverage (%)TK1151 98.104 / OH-1004 98.842
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G305600
LocationChr01:75893187-75899196 (+)
DescriptionSimilar to POT4: Potassium transporter 4
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g02050 High-affinity potassium transporter.
AtKUP1: an Arabidopsis gene encoding high-affinity potassium transport activity.1998 · DOI: 10.1105/tpc.10.1.51
At4g23640 High-affinity potassium transporter required for tip growth of root hairs.
TRH1 encodes a potassium transporter required for tip growth in Arabidopsis root hairs.2001 · DOI: 10.1105/tpc.13.1.139

Rice

Reference gene IDPossible functionPapers / DOI
Os07g0669700 High-affinity potassium transporter.
Inventory and functional characterization of the HAK potassium transporters of rice.2002 · DOI: 10.1104/pp.007781
Os01g0935500 High-affinity potassium transporter.
Rice sodium-insensitive potassium transporter, OsHAK5, confers increased salt tolerance in tobacco BY2 cells.2011 · DOI: 10.1016/j.jbiosc.2010.10.014
Os01g0369300 High-affinity potassium transporter. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_032319 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006813 potassium ion transport Biological Process
GO:0009826 unidimensional cell growth Biological Process
GO:0009932 cell tip growth Biological Process
GO:0048825 cotyledon development Biological Process
GO:0000325 plant-type vacuole Cellular Component
GO:0005739 mitochondrion Cellular Component
GO:0005829 cytosol Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0016020 membrane Cellular Component
GO:0015079 potassium ion transmembrane transporter activity Molecular Function
GO:0015081 sodium ion transmembrane transporter activity Molecular Function
KEGG gene cross-reference
ath:AT3G02050
ath:AT4G23640
dosa:Os01g0369300
dosa:Os01g0935500
dosa:Os07g0669700
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.429
Rank 1 · TkA01G305600 · TK1151
Lysosome / Vacuole0.349
Rank 2 · TkA01G305600 · TK1151
Cytoplasm0.152
Rank 3 · TkA01G305600 · TK1151
Endoplasmic reticulum0.101
Rank 4 · TkA01G305600 · TK1151
Golgi apparatus0.094
Rank 5 · TkA01G305600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02705K_trans27-509 aa
PF14316DUF438155-89 aa
PF14141YqzM349-365 aa
PF31242HGL2_5th364-403 aa
PF14141YqzM431-454 aa
PF17410Stevor469-516 aa
PF14316DUF4381487-514 aa
PF22776K_trans_C539-789 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G305600PF02705K_trans275092.9e-160534.4
TkA01G305600PF14316DUF438155895.28.1
TkA01G305600PF14141YqzM3493652.88.8
TkA01G305600PF31242HGL2_5th3644030.1113.8
TkA01G305600PF14141YqzM4314542.88.8
TkA01G305600PF17410Stevor4695164.77.4
TkA01G305600PF14316DUF43814875145.28.1
TkA01G305600PF22776K_trans_C5397894e-2692.4
TkA01G305600PF31242HGL2_5th6006490.1113.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LD18Arabidopsis thalianasp|Q9LD18|POT4_ARATH Potassium transporter 470.700%Swiss-ProtHigh
Q9FE38Arabidopsis thalianasp|Q9FE38|POT3_ARATH Potassium transporter 356.300%Swiss-ProtHigh
Q8H3P9Oryza sativa subsp. japonicasp|Q8H3P9|HAK7_ORYSJ Potassium transporter 767.700%Swiss-ProtHigh
Q942X8Oryza sativa subsp. japonicasp|Q942X8|HAK2_ORYSJ Probable potassium transporter 264.100%Swiss-ProtHigh
Q5ZC87Oryza sativa subsp. japonicasp|Q5ZC87|HAK3_ORYSJ Probable potassium transporter 358.800%Swiss-ProtHigh

JBrowse

View in Genome Browser