TkA01G298170 | RubberDandelionOmics

Gene overview

TkA01G298170

Reference: TK1151 Chr: Chr01 Coordinates: 74202170-74205421 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2091 bp · TkA01G298170|TK1151|cDNA

ATGGATGCATCTAAAGCCAAAGAGAGAACGATATTAAAAAATCAAATATTGGATAAAAGGAAAGCCGGACAATTAAGCAACATGACAAACGATACAGGTGTTGTTGATAACGATTATAAACATCGAAGGAAACGACGAAAAATGTTGTTGGATGCTAAAAGGCAGAATTCACTTCTTACTACCCAACACGGAATCAAGTATTCTACTGATAATCAAAGTAGAACAACATCGGCTGAAGTTTATAAAGAAAGACGAAAACA...

CDS

Download CDS FASTA

2091 bp · TkA01G298170|TK1151|CDS

ATGGATGCATCTAAAGCCAAAGAGAGAACGATATTAAAAAATCAAATATTGGATAAAAGGAAAGCCGGACAATTAAGCAACATGACAAACGATACAGGTGTTGTTGATAACGATTATAAACATCGAAGGAAACGACGAAAAATGTTGTTGGATGCTAAAAGGCAGAATTCACTTCTTACTACCCAACACGGAATCAAGTATTCTACTGATAATCAAAGTAGAACAACATCGGCTGAAGTTTATAAAGAAAGACGAAAACA...

Protein

Download Protein FASTA

696 aa · TkA01G298170|TK1151|PROTEIN

MDASKAKERTILKNQILDKRKAGQLSNMTNDTGVVDNDYKHRRKRRKMLLDAKRQNSLLTTQHGIKYSTDNQSRTTSAEVYKERRKQRKMYLDKRKSNSVYTNPKSVVDPHLQMYLQYASKISQTYPLHINSSVMPTLKYNLQPISLPNRAYSTLSYATTSRSDTPNVNIRYNEELREQEHIDNSISGVSQDYVDHGDQTHECKTCHAKLWKAETLKGRKKTSFSMCCFNGKVQLPDLKEAPRDYQNLFRSNDAKSKYFL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G298170`
TK1151 ID	TkA01G298170
OH-1004 ID	LXL04_033271
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	61.700
Protein coverage (%)	TK1151 75.575 / OH-1004 28.862 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G298170`
Location	Chr01:74202170-74205421 (-)
Description	Similar to Pif1: ATP-dependent DNA helicase PIF1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_033271` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000722 telomere maintenance via recombination Biological Process GO:0000723 telomere maintenance Biological Process GO:0000724 double-strand break repair via homologous recombination Biological Process GO:0000727 double-strand break repair via break-induced replication Biological Process GO:0001117 protein-DNA-RNA complex disassembly Biological Process GO:0006260 DNA replication Biological Process GO:0006281 DNA repair Biological Process GO:0006289 nucleotide-excision repair Biological Process GO:0006310 DNA recombination Biological Process GO:0007004 telomere maintenance via telomerase Biological Process GO:0007140 male meiotic nuclear division Biological Process GO:0009555 pollen development Biological Process
KEGG gene cross-reference	cal:CAALFM_CR07360WA dosa:Os02g0776800 hsa:80119 mmu:208084 rno:367645 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.940

Rank 1 · TkA01G298170 · TK1151

Cytoplasm0.164

Rank 2 · TkA01G298170 · TK1151

Mitochondrion0.028

Rank 3 · TkA01G298170 · TK1151

Cell membrane0.013

Rank 4 · TkA01G298170 · TK1151

Endoplasmic reticulum0.006

Rank 5 · TkA01G298170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12433PV_NSP128-58 aa

PF14214Helitron_like_N71-71 aa

PF12433PV_NSP181-103 aa

PF12433PV_NSP1244-262 aa

PF14214Helitron_like_N451-624 aa

PF23343REP_ORF2-G2P582-637 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G298170	`PF12433`	PV_NSP1	28	58	0.1	13.7
TkA01G298170	`PF14214`	Helitron_like_N	71	71	1.4e-55	189.2
TkA01G298170	`PF12433`	PV_NSP1	81	103	0.1	13.7
TkA01G298170	`PF12433`	PV_NSP1	244	262	0.1	13.7
TkA01G298170	`PF14214`	Helitron_like_N	451	624	1.4e-55	189.2
TkA01G298170	`PF23343`	REP_ORF2-G2P	582	637	0.00075	20.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card