TkA01G277090 | RubberDandelionOmics

Gene overview

TkA01G277090

Reference: TK1151 Chr: Chr01 Coordinates: 69296083-69297170 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

450 bp · TkA01G277090|TK1151|cDNA

ATGGCTCCCTCGTTAAATCTCAAGACATTGACTCCAAATCTGCAGCCAATAAAAACCCAACACCTCATTGATGAAATTTTCATGCACTACAAGAAACAAGAGGTATTAAGTTGTATTTCACAACCATACATGTCAAAACAACATGACATAACTGATAGAATGAGAGGCATTCTCATTGATTGGCTAGATGAGGTTCATTACAAATTTGAACTGGAACGTCAAACAGGAGAAGGAAATGGCGAGTACCCTTCAGTTAACTC...

CDS

Download CDS FASTA

450 bp · TkA01G277090|TK1151|CDS

ATGGCTCCCTCGTTAAATCTCAAGACATTGACTCCAAATCTGCAGCCAATAAAAACCCAACACCTCATTGATGAAATTTTCATGCACTACAAGAAACAAGAGGTATTAAGTTGTATTTCACAACCATACATGTCAAAACAACATGACATAACTGATAGAATGAGAGGCATTCTCATTGATTGGCTAGATGAGGTTCATTACAAATTTGAACTGGAACGTCAAACAGGAGAAGGAAATGGCGAGTACCCTTCAGTTAACTC...

Protein

Download Protein FASTA

149 aa · TkA01G277090|TK1151|PROTEIN

MAPSLNLKTLTPNLQPIKTQHLIDEIFMHYKKQEVLSCISQPYMSKQHDITDRMRGILIDWLDEVHYKFELERQTGEGNGEYPSVNSFCPYPICFYQESSERASETNSGSQTVMIATICKTASHQQHDEELDVLSASVEKDWILRMQES

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G277090`
TK1151 ID	TkA01G277090
OH-1004 ID	LXL04_003763
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G277090

Location Chr01:69296083-69297170 (+)

Description Similar to CYCB2-4: Cyclin-B2-4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g76310`	Cyclin-B2-4.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YH60`	Involved in the control of the cell cycle at the G2/M (mitosis) transition.	No verified direct reference in this release
`Os06g0726800`	Involved in the control of the cell cycle at the G2/M (mitosis) transition.	No verified direct reference in this release
`Os04g0563700`	Involved in the control of the cell cycle at the G2/M (mitosis) transition.	No verified direct reference in this release
`UniProt: Q01J96`	Involved in the control of the cell cycle at the G2/M (mitosis) transition.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003763 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000082 G1/S transition of mitotic cell cycle Biological Process

GO:0010332 response to gamma radiation Biological Process

GO:0044772 mitotic cell cycle phase transition Biological Process

GO:0051301 cell division Biological Process

GO:0000307 cyclin-dependent protein kinase holoenzyme complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0016538 cyclin-dependent protein serine/threonine kinase regulator activity Molecular Function

KEGG gene cross-reference

ath:AT1G20610

ath:AT1G76310

dosa:Os06g0726800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.497

Rank 1 · TkA01G277090 · TK1151

Cytoplasm0.423

Rank 2 · TkA01G277090 · TK1151

Mitochondrion0.119

Rank 3 · TkA01G277090 · TK1151

Cell membrane0.068

Rank 4 · TkA01G277090 · TK1151

Endoplasmic reticulum0.046

Rank 5 · TkA01G277090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00134Cyclin_N25-75 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G277090	`PF00134`	Cyclin_N	25	75	1.1e-10	42.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SFW6`	Arabidopsis thaliana	sp\|Q9SFW6\|CCB24_ARATH Cyclin-B2-4	55.000%	Swiss-Prot	Low
`A2YH60`	Oryza sativa subsp. indica	sp\|A2YH60\|CCB22_ORYSI Cyclin-B2-2	58.500%	Swiss-Prot	Low
`Q0D9C7`	Oryza sativa subsp. japonica	sp\|Q0D9C7\|CCB22_ORYSJ Cyclin-B2-2	58.500%	Swiss-Prot	Low
`Q7XSJ6`	Oryza sativa subsp. japonica	sp\|Q7XSJ6\|CCB21_ORYSJ Cyclin-B2-1	46.700%	Swiss-Prot	Low
`Q01J96`	Oryza sativa subsp. indica	sp\|Q01J96\|CCB21_ORYSI Cyclin-B2-1	46.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card