Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3561 bp · TkA01G259930|TK1151|cDNA
TGTTAATAGGTATCGACAAAAAGGAATGTACGACATTCAGTTTGAGAAGAGAGGAAACGCATGTGTTTTTGGTGGCGGATCCTCCAAATCCCCATTTTATCTTGTTCCTCCAAAACCAATTTCCTCAATTTCTCCTCTTTGGATTCTCATTTCTTCCCTCTCTCTTCTGTTTCATTGTGTTCTCCAATTGTTGTAATCGATACAATGTCTCTATATGTCTCCTCTCCACATCTATATATCGTTCTAAATTTTCAGCTTCA...
1581 bp · TkA01G259930|TK1151|CDS
ATGTGTTGTGCAGTGATAAAAACCGGCACCTTAACCCTCAACAAACTTACAGTCGACAAAAACTTGATCGAGGTGTTTGCCAGTGGTGTTGATAAAGACACGGTTGTGTTAATGGCTGCAAGAGCCTCAAGGTTGGAAAACCAGGATGCCATTGATACTGCTATAGTGTCTATGCTTGCTGATCCCAAGGAGGCGCGATATGGGATCACAGAAGTCCACTTCCTTCCCTTCAATCCGACTGATAAGAGGACGGCTTTGAC...
Protein
Download Protein FASTA526 aa · TkA01G259930|TK1151|PROTEIN
MCCAVIKTGTLTLNKLTVDKNLIEVFASGVDKDTVVLMAARASRLENQDAIDTAIVSMLADPKEARYGITEVHFLPFNPTDKRTALTYIDGAGKMHRVSKGAPEQILNLAKNRSEIENRVHSVIDKFAERGLRSLGIARQEVPANSKDSPGGPWEFVGLLPLFDPPRHDSAETIRRALDLGVSVKMITGDQLAIAKETGRRLGMGVNMYPSSSLLGDHKDHLVAALPTDELIEKADGFAGVFPEHKYEIVKILQSKKHIC...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G259930 |
|---|---|
| TK1151 ID | TkA01G259930 |
| OH-1004 ID | LXL04_003879 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 95.700 |
| Protein coverage (%) | TK1151 98.479 / OH-1004 54.888Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G259930 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:65440639-65448109 (+) | |||||||||
| Description | Similar to AHA11: ATPase 11, plasma membrane-type | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0009651 response to salt stress Biological Process GO:0051453 regulation of intracellular pH Biological Process GO:0120029 proton export across plasma membrane Biological Process GO:1902600 proton transmembrane transport Biological Process GO:0005886 plasma membrane Cellular Component GO:0003729 mRNA binding Molecular Function GO:0005524 ATP binding Molecular Function GO:0008553 P-type proton-exporting transporter activity Molecular Function GO:0016887 ATP hydrolysis activity Molecular Function GO:0046872 metal ion binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT3G47950 ath:AT3G60330 ath:AT5G62670 sly:543982 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF08282Hydrolase_318-49 aaPF13246Cation_ATPase48-168 aaPF00702Hydrolase144-277 aaPF08282Hydrolase_3252-297 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G259930 | PF08282 | Hydrolase_3 | 18 | 49 | 0.0004 | 20.9 |
| TkA01G259930 | PF13246 | Cation_ATPase | 48 | 168 | 4.6e-06 | 27.3 |
| TkA01G259930 | PF00702 | Hydrolase | 144 | 277 | 1.7e-11 | 45.6 |
| TkA01G259930 | PF08282 | Hydrolase_3 | 252 | 297 | 0.0004 | 20.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.