LXL04_003879 | RubberDandelionOmics

Gene overview

LXL04_003879

Reference: OH-1004 Chr: Chr01 Coordinates: 111483458-111489993 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2949 bp · LXL04_003879|LXL04_003879|OH1004|cDNA

ATGGATAACGACAAGACAATTGCTCTTGAGGCTATCAACAAAGAAGCTGTTGATTTGGAAAATATACCCGTGGAAGAAGTATTTGACAAGTTAAAATGCACGAAAGAAGGACTGAGTTCTGATGAGGTTGAAAAGCGTTTAAATATGTTTGGGTACAACAAGTTGGAAGAAAAAAAGGAAAATAAATTGCTCAAGTTTTTGGGGTTTATGTGGAATCCTCTCTCTTGGGTGATGGAAGCAGCGGCAATCATGGCAATTGC...

CDS

Download CDS FASTA

2949 bp · LXL04_003879|LXL04_003879|OH1004|CDS

ATGGATAACGACAAGACAATTGCTCTTGAGGCTATCAACAAAGAAGCTGTTGATTTGGAAAATATACCCGTGGAAGAAGTATTTGACAAGTTAAAATGCACGAAAGAAGGACTGAGTTCTGATGAGGTTGAAAAGCGTTTAAATATGTTTGGGTACAACAAGTTGGAAGAAAAAAAGGAAAATAAATTGCTCAAGTTTTTGGGGTTTATGTGGAATCCTCTCTCTTGGGTGATGGAAGCAGCGGCAATCATGGCAATTGC...

Protein

Download Protein FASTA

982 aa · LXL04_003879|LXL04_003879|OH1004|PROTEIN

MDNDKTIALEAINKEAVDLENIPVEEVFDKLKCTKEGLSSDEVEKRLNMFGYNKLEEKKENKLLKFLGFMWNPLSWVMEAAAIMAIAMARGGGEPADYHDFGGILVLLLINSTISFVEENNAGNAAAALMARLAPRAKVLRDGKWNEEDAAVLVPGDIISIKLGDIIPADARLLQGDPLKIDQSALTGESLPVSKNPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDNTTHVGHFQQVLTAIGNFCICSIAIGM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003879`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003879

Location Chr01:111483458-111489993 (+)

Description Similar to AHA11: ATPase 11, plasma membrane-type

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g62670`	The plasma membrane H(+) ATPase of plants and fungi generates a proton gradient that drives the active transport of nutrients by H(+)-symport.	No verified direct reference in this release
`At3g60330`	The plasma membrane H(+) ATPase of plants and fungi generates a proton gradient that drives the active transport of nutrients by H(+)-symport.	No verified direct reference in this release
`At3g47950`	The plasma membrane H(+) ATPase of plants and fungi generates a proton gradient that drives the active transport of nutrients by H(+)-symport.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003879 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009651 response to salt stress Biological Process

GO:0051453 regulation of intracellular pH Biological Process

GO:0120029 proton export across plasma membrane Biological Process

GO:1902600 proton transmembrane transport Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0008553 P-type proton-exporting transporter activity Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G47950

ath:AT3G60330

ath:AT5G62670

sly:543982

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.641

Rank 1 · LXL04_003879 · OH-1004

Endoplasmic reticulum0.149

Rank 2 · LXL04_003879 · OH-1004

Cytoplasm0.116

Rank 3 · LXL04_003879 · OH-1004

Lysosome / Vacuole0.095

Rank 4 · LXL04_003879 · OH-1004

Golgi apparatus0.088

Rank 5 · LXL04_003879 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00690.32Cation_ATPase_N21-84 aa

PF00122.26E1-E2_ATPase133-232 aa

PF00702.33Hydrolase328-626 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003879	`PF00690.32`	Cation_ATPase_N	21	84	1.4e-15	57.4
LXL04_003879	`PF00122.26`	E1-E2_ATPase	133	232	1.2e-32	112.4
LXL04_003879	`PF00702.33`	Hydrolase	328	626	4.2e-12	47.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LV11`	Arabidopsis thaliana	ATPase 11, plasma membrane-type	76.758%	Swiss-Prot	strong database homology
`Q9LY32`	Arabidopsis thaliana	ATPase 7, plasma membrane-type	75.926%	Swiss-Prot	strong database homology
`Q9SU58`	Arabidopsis thaliana	ATPase 4, plasma membrane-type	76.453%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card