TkA01G240760 | RubberDandelionOmics

Gene overview

TkA01G240760

Reference: TK1151 Chr: Chr01 Coordinates: 60904946-60907997 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1203 bp · TkA01G240760|TK1151|cDNA

AAAAACCTTTGTGTACAAATCAGCTCCCCTAATTAAATCATACAGTTACGTCAACTTTCTTTTAGAAACTACAATAGAAATGTAGATTTGAGTTTATATAAAGAGGTCATTTAGAATCCTTTGGTTATTAAAAGTTGTAATGGGTATCTGCATATCCCGGGCATCTCCAGAGATTCATGAGATCGACTATGGCCATGAAAATGTTATTTATTACCAACACACCCTTTCTGATAAGAGAATCGGTTCTATCAATACACATC...

CDS

Download CDS FASTA

1017 bp · TkA01G240760|TK1151|CDS

ATGGGTATCTGCATATCCCGGGCATCTCCAGAGATTCATGAGATCGACTATGGCCATGAAAATGTTATTTATTACCAACACACCCTTTCTGATAAGAGAATCGGTTCTATCAATACACATCAAGGATCCAAAGGACTTAATCAAGATGCTGCCATCCTTTACCAGGACTACGGACTCGAAGATGGGGCATTTGGTGGGGTGTTTGATGGACATGGAAGGAATGGTCAAATAGTGAGTAAATTTGAGAGAAACAAACTTCC...

Protein

Download Protein FASTA

338 aa · TkA01G240760|TK1151|PROTEIN

MGICISRASPEIHEIDYGHENVIYYQHTLSDKRIGSINTHQGSKGLNQDAAILYQDYGLEDGAFGGVFDGHGRNGQIVSKFERNKLPSLIIIERNSTISKGKTVYEDEENESKEFQIWRDACYNAFKVMDKEIKLIEHVDCSCSGTTAVIVIKQAEDLIIANLGDSRAVLGTIAENGIMPVQLTIDLKPSVPSEADRIRKSNGRVMALREEPHIDRVWLPYHDSPGLAMSRAFGDFVLKSHGIIAVPDVSYHRLTTNDQF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G240760`
TK1151 ID	TkA01G240760
OH-1004 ID	LXL04_025481
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	44.500
Protein coverage (%)	TK1151 87.278 / OH-1004 67.841 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G240760

Location Chr01:60904946-60907997 (-)

Description Similar to At4g03415: Probable protein phosphatase 2C 52

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g26010`	Probable protein phosphatase 2C 72.	No verified direct reference in this release
`At4g32950`	Probable protein phosphatase 2C 61.	No verified direct reference in this release
`At4g03415`	Probable protein phosphatase 2C 52.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0224100`	Probable protein phosphatase 2C 12.	No verified direct reference in this release
`Os02g0471500`	Probable protein phosphatase 2C 14.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025481 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006470 protein dephosphorylation Biological Process

GO:1902531 regulation of intracellular signal transduction Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004721 phosphoprotein phosphatase activity Molecular Function

GO:0004722 protein serine/threonine phosphatase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G03590

ath:AT1G16220

ath:AT1G79630

ath:AT4G03415

dosa:Os07g0566200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.543

Rank 1 · TkA01G240760 · TK1151

Nucleus0.368

Rank 2 · TkA01G240760 · TK1151

Cell membrane0.123

Rank 3 · TkA01G240760 · TK1151

Lysosome / Vacuole0.095

Rank 4 · TkA01G240760 · TK1151

Mitochondrion0.068

Rank 5 · TkA01G240760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00481PP2C47-300 aa

PF13672PP2C_2108-170 aa

PF13672PP2C_2247-278 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G240760	`PF00481`	PP2C	47	300	4.6e-43	148.4
TkA01G240760	`PF13672`	PP2C_2	108	170	0.0075	16.6
TkA01G240760	`PF13672`	PP2C_2	247	278	0.0075	16.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XGZ9`	Arabidopsis thaliana	sp\|Q9XGZ9\|P2C72_ARATH Probable protein phosphatase 2C 72	51.300%	Swiss-Prot	High
`O82637`	Arabidopsis thaliana	sp\|O82637\|P2C61_ARATH Probable protein phosphatase 2C 61	51.200%	Swiss-Prot	High
`Q8GY60`	Arabidopsis thaliana	sp\|Q8GY60\|P2C52_ARATH Probable protein phosphatase 2C 52	43.400%	Swiss-Prot	Medium
`Q6Z8B9`	Oryza sativa subsp. japonica	sp\|Q6Z8B9\|P2C12_ORYSJ Probable protein phosphatase 2C 12	45.200%	Swiss-Prot	Medium
`Q6K6N7`	Oryza sativa subsp. japonica	sp\|Q6K6N7\|P2C14_ORYSJ Probable protein phosphatase 2C 14	51.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card