TkA01G238790 | RubberDandelionOmics

Gene overview

TkA01G238790

Reference: TK1151 Chr: Chr01 Coordinates: 60406748-60414460 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5230 bp · TkA01G238790|TK1151|cDNA

TGGTCGAAAATAGATTATATTTACAACAAATTATTAATTTACAGCAAAAGAAAAACTAGAAACTAAATGGGGATGGTCATACAGATTTGTGAACACTGAACATTAGATCAGCAGTACTTTGAGACCCGTCTTCGTTGTTCCCGTTTGGATCCTCTCCTCGACCTCCCAGCTATGCTTATTAACAAATAACAACGCAAAACCTGACGTCCTCCTGAATCTCAATTAAGATTGACCGGCGCAGATGTCGTCGTCGCAGTGAT...

CDS

Download CDS FASTA

3909 bp · TkA01G238790|TK1151|CDS

ATGGAACCACCTGCTGGTGGGCTGCGGGATACATCTGTTATTGTTGTTACACTTGATACGAGTGAGGTATATATAATTGTGAGCTTGTCATCTAGGAAGGACACTGAGGTCGTATATATCGATCCAACAACAGGATCTCTTAGACATGAAAAGAAGCTCGGTTATGACGTTTTCAACTCCCAAGAAGAGGCATTAACCAGCATTACAAATGGTTCAAGATCGGTTTGCAAAAGTGTAATTTATGGCAAAGCCATATTAGG...

Protein

Download Protein FASTA

1302 aa · TkA01G238790|TK1151|PROTEIN

MEPPAGGLRDTSVIVVTLDTSEVYIIVSLSSRKDTEVVYIDPTTGSLRHEKKLGYDVFNSQEEALTSITNGSRSVCKSVIYGKAILGYAVLGSSGLLLVATKLTASIPNLPGGGCVYTVSESQWIKVLLQNPQPHGKGEVKNIQELAELDIDGKHYFCETRDITRPFPSHASVRNPDEEFVWNGWFSSSFMRIGLEQHCVILLQGFAECRSFGSSGQQEGVVALIARRSRLHPGTRYLARGINSCYSTGNEVECEQLVWV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G238790`
TK1151 ID	TkA01G238790
OH-1004 ID	LXL04_003908
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.600
Protein coverage (%)	TK1151 92.089 / OH-1004 77.355 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G238790

Location Chr01:60406748-60414460 (-)

Description Similar to SAC9: Probable phosphoinositide phosphatase SAC9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g59770`	Probable phosphoinositide phosphatase that could be involved in stress signaling.	Mutations in the Arabidopsis phosphoinositide phosphatase gene SAC9 lead to overaccumulation of PtdIns(4,5)P2 and constitutive expression of the stress-response pathway.2005 · DOI: 10.1104/pp.105.061317
`At1g17340`	The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003908 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0007010 cytoskeleton organization Biological Process

GO:0009409 response to cold Biological Process

GO:0009644 response to high light intensity Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009832 plant-type cell wall biogenesis Biological Process

GO:0036092 phosphatidylinositol-3-phosphate biosynthetic process Biological Process

GO:0046488 phosphatidylinositol metabolic process Biological Process

GO:0046856 phosphatidylinositol dephosphorylation Biological Process

GO:0048015 phosphatidylinositol-mediated signaling Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G17340

ath:AT1G22620

ath:AT3G43220

ath:AT3G59770

spo:3361401

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.281

Rank 1 · TkA01G238790 · TK1151

Endoplasmic reticulum0.278

Rank 2 · TkA01G238790 · TK1151

Nucleus0.211

Rank 3 · TkA01G238790 · TK1151

Golgi apparatus0.189

Rank 4 · TkA01G238790 · TK1151

Cell membrane0.146

Rank 5 · TkA01G238790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02383Syja_N84-385 aa

PF24789SAC9_GBDL_2nd383-401 aa

PF30846CEP164_N470-537 aa

PF00397WW504-534 aa

PF24790SAC9_GBDL_1st649-831 aa

PF24789SAC9_GBDL_2nd677-731 aa

PF24791SAC9_C8D1038-1104 aa

PF24789SAC9_GBDL_2nd1167-1204 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G238790	`PF02383`	Syja_N	84	385	2.1e-41	143.0
TkA01G238790	`PF24789`	SAC9_GBDL_2nd	383	401	2.3e-12	47.7
TkA01G238790	`PF30846`	CEP164_N	470	537	2.8e-05	24.7
TkA01G238790	`PF00397`	WW	504	534	3.1e-12	47.0
TkA01G238790	`PF24790`	SAC9_GBDL_1st	649	831	1.1e-84	283.3
TkA01G238790	`PF24789`	SAC9_GBDL_2nd	677	731	2.3e-12	47.7
TkA01G238790	`PF24791`	SAC9_C8D	1038	1104	2.5e-10	41.4
TkA01G238790	`PF24789`	SAC9_GBDL_2nd	1167	1204	2.3e-12	47.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7XZU0`	Arabidopsis thaliana	sp\|Q7XZU0\|SAC9_ARATH Probable phosphoinositide phosphatase SAC9	62.600%	Swiss-Prot	High
`Q8RW97`	Arabidopsis thaliana	sp\|Q8RW97\|SAC5_ARATH Phosphoinositide phosphatase SAC5	29.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card